rpcs3_version: Bump to 0.0.14

* Initial playlist-based custom soundtracks support

This is the initial implementation of playlist-based (cellSearch) custom soundtracks support.
It is based on the initial work by @Megamouse and currently uses a directory-based approach to manage albums and utilizes FFMPEG to read audio metadata.

Background: The real PS3 can import music in XMB from USB into its internal storage (/dev_hdd0/music) and additionally stores metadata (artist, trackname, tracknumber, ...) in a database (/dev_hdd0/mms/db/metadata_db_hdd). Games can make use of imported music via cellSearch.

For the time being, this implementation does NOT make use of metadata_db_hdd as the db-format is not well understood and a folder-based approch is easier to use. Users only have to create folders inside /dev_hdd0/music and add music to it to create a "playlist". This playlists contents will be sorted alphabetically. As a result, users could prefix numbers to the audio-files to force a specific order.

The only really supported audio format is MP3. I also added support for AAC, AC3, WMA, ATRAC3 and ATRAC3 plus, however, non of these formats were successfully tested for several reasons. AC3 and WMA are not enabled in the current FFMPEG build which makes reading codec-specific data impossible. We could enable these later if we want to. AAC actually could work but I was not able to get it working in WipeOut HD Fury. My guess is that the game does not support AAC. Finally, I could not find any ATRAC3 (or Plus) music to test with.

This implementation currently only implements parts of cellSearchStartListSearch() and cellSearchStartContentSearchInList(). There are several other functions which are still completely unimplemented and will probably be needed by other games. However, this implementation is a starting-point and is enough for WipeOut and maybe a few other games.

A video which showcases this custom soundtrack support is available here: https://www.youtube.com/watch?v=4nu1OCtONTY

Next steps:
 - Utilize sortKey in cellSearchStartContentSearchInList()
 - Eliminate TODOs
 - Implement the missing other functions
 - Test on more games - I do not own many that support custom soundtracks

Signed-off-by: gladiac1337 <gladiac@gmail.com>

Co-authored-by: Megamouse <studienricky89@googlemail.com>
Co-authored-by: Ani <ani-leo@outlook.com>
Co-authored-by: Ivan <nekotekina@gmail.com>

.ci/build-freebsd.sh

@@ -0,0 +1,29 @@
+#!/bin/sh -ex
+
+# Pull all the submodules except llvm
+# Note: Tried to use git submodule status, but it takes over 20 seconds
+# shellcheck disable=SC2046
+git submodule -q update --init --depth 1 $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
+
+# Prefer newer Clang than in base system (see also .ci/install-freebsd.sh)
+# libc++ isn't in llvm* packages, so download manually
+fetch https://github.com/llvm/llvm-project/releases/download/llvmorg-11.0.0/libcxx-11.0.0.src.tar.xz
+tar xf libcxx-11.0.0.src.tar.xz
+export CC=clang11 CXX=clang++11
+export CXXFLAGS="$CXXFLAGS -nostdinc++ -isystem $PWD/libcxx-11.0.0.src/include"
+
+CONFIGURE_ARGS="
+	-DWITH_LLVM=OFF
+	-DUSE_PRECOMPILED_HEADERS=OFF
+	-DUSE_NATIVE_INSTRUCTIONS=OFF
+	-DUSE_SYSTEM_FFMPEG=ON
+	-DUSE_SYSTEM_CURL=ON
+	-DUSE_SYSTEM_LIBPNG=ON
+"
+
+# shellcheck disable=SC2086
+cmake -B build -G Ninja $CONFIGURE_ARGS
+cmake --build build
+
+ccache --show-stats
+ccache --zero-stats

.ci/build-linux.sh

@@ -25,8 +25,8 @@ if [ "$COMPILER" = "gcc" ]; then
     export CXX=${GXX_BINARY}
     export LINKER=gold
     # We need to set the following variables for LTO to link properly
-    export AR=/usr/bin/gcc-ar-9
-    export RANLIB=/usr/bin/gcc-ranlib-9
+    export AR=/usr/bin/gcc-ar-$GCCVER
+    export RANLIB=/usr/bin/gcc-ranlib-$GCCVER
     export CFLAGS="-fuse-linker-plugin"
 else
     export CC=${CLANG_BINARY}
@@ -48,17 +48,16 @@ cmake ..                                               \
     -DCMAKE_CXX_FLAGS="$CFLAGS"                        \
     -DCMAKE_AR="$AR"                                   \
     -DCMAKE_RANLIB="$RANLIB"                           \
+    -DUSE_SYSTEM_CURL=ON                               \
     -G Ninja
 
 ninja; build_status=$?;
 
 cd ..
 
-# If it compiled succesfully let's deploy depending on the build pipeline (Travis, Azure Pipelines).
-# Travis only deploys on master, and it publishes to GitHub releases. Azure publishes PRs as artifacts
-# only.
-{   [ "$IS_AZURE" = "true" ] ||
-    { [ "$TRAVIS_BRANCH" = "master" ] && [ "$TRAVIS_PULL_REQUEST" = "false" ]; };
+# If it compiled succesfully let's deploy depending on the build pipeline (Azure Pipelines).
+# Azure publishes PRs as artifacts only.
+{   [ "$IS_AZURE" = "true" ];
 } && SHOULD_DEPLOY="true" || SHOULD_DEPLOY="false"
 
 if [ "$build_status" -eq 0 ] && [ "$SHOULD_DEPLOY" = "true" ]; then

.ci/deploy-linux.sh

@@ -41,7 +41,6 @@ if [ "$DEPLOY_APPIMAGE" = "true" ]; then
     COMM_HASH="$(git rev-parse --short=8 HEAD)"
     RPCS3_APPIMAGE="rpcs3-v${COMM_TAG}-${COMM_COUNT}-${COMM_HASH}_linux64.AppImage"
 
-    curl -sLO https://github.com/hcorion/uploadtool/raw/master/upload.sh
     mv ./RPCS3*.AppImage "$RPCS3_APPIMAGE"
 
     # If we're building using Azure Pipelines, let's copy over the AppImage artifact
@@ -50,16 +49,9 @@ if [ "$DEPLOY_APPIMAGE" = "true" ]; then
     fi
 
     FILESIZE=$(stat -c %s ./rpcs3*.AppImage)
-    SHA256SUM=$(sha256sum ./rpcs3*.AppImage)
-    if [ -n "$GITHUB_TOKEN" ]; then
-        unset TRAVIS_REPO_SLUG
-        REPO_SLUG=RPCS3/rpcs3-binaries-linux \
-            UPLOADTOOL_BODY="$SHA256SUM;${FILESIZE}B"\
-            RELEASE_NAME=build-${TRAVIS_COMMIT}\
-            RELEASE_TITLE=${COMM_TAG}-${COMM_COUNT}\
-            REPO_COMMIT=d812f1254a1157c80fd402f94446310560f54e5f\
-            bash upload.sh rpcs3*.AppImage
-    fi
+    SHA256SUM=$(sha256sum ./rpcs3*.AppImage | awk '{ print $1 }')
+    echo "${SHA256SUM};${FILESIZE}B" > /rpcs3/GitHubReleaseMessage.txt
+    
 fi
 
 if [ "$DEPLOY_PPA" = "true" ]; then

.ci/docker.env

@@ -1,7 +1,3 @@
-# Variables set by Travis CI
-TRAVIS_PULL_REQUEST
-TRAVIS_BRANCH
-TRAVIS_COMMIT
 # Variables set by Azure Pipelines
 IS_AZURE
 BUILD_REASON
@@ -9,8 +5,8 @@ BUILD_SOURCEVERSION
 BUILD_ARTIFACTSTAGINGDIRECTORY
 BUILD_REPOSITORY_NAME
 BUILD_SOURCEBRANCHNAME
-# Variables for Travis build matrix
+# Variables for build matrix
 COMPILER
 DEPLOY_APPIMAGE
-# Private Travis CI variables
+# Private variables
 GITHUB_TOKEN

.ci/get_keys-windows.sh

@@ -0,0 +1,4 @@
+#!/bin/sh -ex
+
+curl -L -o "./llvm.lock" "https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z.sha256"
+curl -L -o "./glslang.lock" "https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z.sha256"

.ci/github-upload.sh

@@ -0,0 +1,42 @@
+#!/bin/sh -ex
+
+ARTIFACT_DIR="$BUILD_ARTIFACTSTAGINGDIRECTORY"
+generate_post_data()
+{
+    body=$(cat GitHubReleaseMessage.txt)
+    cat <<EOF
+    {
+    "tag_name": "build-${BUILD_SOURCEVERSION}",
+    "target_commitish": "${UPLOAD_COMMIT_HASH}",
+    "name": "${AVVER}",
+    "body": "$body",
+    "draft": false,
+    "prerelease": false
+    }
+EOF
+}
+
+curl -s \
+    -H "Authorization: token ${RPCS3_TOKEN}" \
+    -H "Accept: application/vnd.github.v3+json" \
+    --data "$(generate_post_data)" "https://api.github.com/repos/$UPLOAD_REPO_FULL_NAME/releases" >> release.json
+
+cat release.json
+id=$(grep '"id"' release.json | cut -d ':' -f2 | head -n1 | awk '{$1=$1;print}')
+id=${id%?}
+echo ${id:?}
+
+upload_file()
+{
+    curl -s \
+        -H "Authorization: token ${RPCS3_TOKEN}" \
+        -H "Accept: application/vnd.github.v3+json" \
+        -H "Content-Type: application/octet-stream" \
+        --data-binary @"$2"/"$3" \
+        "https://uploads.github.com/repos/$UPLOAD_REPO_FULL_NAME/releases/$1/assets?name=$3"
+}
+
+for file in "$ARTIFACT_DIR"/*; do
+    name=$(basename "$file")
+    upload_file "$id" "$ARTIFACT_DIR" "$name"
+done

.ci/install-freebsd.sh

@@ -0,0 +1,18 @@
+#!/usr/bin/env -S su -m root -ex
+# NOTE: this script is run under root permissions
+# shellcheck shell=sh disable=SC2096
+
+# RPCS3 often needs recent Qt5 and Vulkan-Headers
+sed -i '' 's/quarterly/latest/' /etc/pkg/FreeBSD.conf
+
+export ASSUME_ALWAYS_YES=true
+pkg info # debug
+
+# Prefer newer Clang than in base system (see also .ci/build-freebsd.sh)
+pkg install llvm11
+
+# Mandatory dependencies (qt5-dbus and qt5-gui are pulled via qt5-widgets)
+pkg install git ccache cmake ninja qt5-qmake qt5-buildtools qt5-widgets qt5-concurrent glew openal-soft ffmpeg
+
+# Optional dependencies (libevdev is pulled by qt5-gui)
+pkg install pkgconf alsa-lib pulseaudio sdl2 evdev-proto vulkan-headers vulkan-loader

.ci/setup-windows.sh

@@ -7,18 +7,19 @@ PR_NUMBER="$SYSTEM_PULLREQUEST_PULLREQUESTID"
 
 # Resource/dependency URLs
 # Qt mirrors can be volatile and slow, so we list 2
-#QT_HOST="http://mirrors.ocf.berkeley.edu/qt/"
-QT_HOST="http://qt.mirror.constant.com/"
+QT_HOST="http://mirrors.ocf.berkeley.edu/qt/"
+#QT_HOST="http://qt.mirror.constant.com/"
 QT_URL_VER=$(echo "$QT_VER" | sed "s/\.//g")
-QT_PREFIX="online/qtsdkrepository/windows_x86/desktop/qt5_${QT_URL_VER}/qt.qt5.${QT_URL_VER}.win64_msvc2017_64/${QT_VER}-0-${QT_DATE}"
-QT_SUFFIX="-Windows-Windows_10-MSVC2017-Windows-Windows_10-X86_64.7z"
+QT_VER_MSVC_UP=$(echo ${QT_VER_MSVC} | tr '[:lower:]' '[:upper:]')
+QT_PREFIX="online/qtsdkrepository/windows_x86/desktop/qt${QT_VER_MAIN}_${QT_URL_VER}/qt.qt${QT_VER_MAIN}.${QT_URL_VER}.win64_${QT_VER_MSVC}_64/${QT_VER}-0-${QT_DATE}"
+QT_SUFFIX="-Windows-Windows_10-${QT_VER_MSVC_UP}-Windows-Windows_10-X86_64.7z"
 QT_BASE_URL="${QT_HOST}${QT_PREFIX}qtbase${QT_SUFFIX}"
 QT_WINE_URL="${QT_HOST}${QT_PREFIX}qtwinextras${QT_SUFFIX}"
 QT_DECL_URL="${QT_HOST}${QT_PREFIX}qtdeclarative${QT_SUFFIX}"
 QT_TOOL_URL="${QT_HOST}${QT_PREFIX}qttools${QT_SUFFIX}"
 LLVMLIBS_URL='https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z'
 GLSLANG_URL='https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z'
-VULKAN_SDK_URL="https://sdk.lunarg.com/sdk/download/${VULKAN_VER}/windows/VulkanSDK-${VULKAN_VER}-Installer.exe"
+VULKAN_SDK_URL="https://www.dropbox.com/s/kn005de7gsv5whe/VulkanSDK-1.2.154.1-Installer.exe"
 
 DEP_URLS="         \
     $QT_BASE_URL   \
@@ -35,7 +36,7 @@ DEP_URLS="         \
 # Pull all the submodules except llvm, since it is built separately and we just download that build
 # Note: Tried to use git submodule status, but it takes over 20 seconds
 # shellcheck disable=SC2046
-git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
+git submodule -q update --init --depth 1 $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
 
 # Git bash doesn't have rev, so here it is
 rev()

.cirrus.yml

@@ -0,0 +1,19 @@
+env:
+  CIRRUS_CLONE_DEPTH: 0 # Unshallow clone to obtain proper GIT_VERSION
+
+freebsd_task:
+  matrix:
+    - name: FreeBSD 12.2
+      freebsd_instance:
+        image_family: freebsd-12-2
+        cpu: 8
+        memory: 8G
+  env:
+    CCACHE_MAXSIZE: 300M # 3x clean build, rounded
+    CCACHE_DIR: /tmp/ccache_dir
+  ccache_cache:
+    folder: /tmp/ccache_dir
+  packages_cache:
+    folder: /var/cache/pkg
+  install_script: "sh -ex ./.ci/install-freebsd.sh"
+  script: "./.ci/build-freebsd.sh"

.clang-format

@@ -1,20 +1,20 @@
-Standard: Cpp11
+Standard: c++20
 UseTab: ForIndentation
-TabWidth: 1
-IndentWidth: 1
-AccessModifierOffset: -1
+TabWidth: 4
+IndentWidth: 4
+AccessModifierOffset: -4
 PointerAlignment: Left
 NamespaceIndentation: All
-ColumnLimit: 200
+ColumnLimit: 0
 BreakBeforeBraces: Allman
-BreakConstructorInitializersBeforeComma: true
-BreakBeforeBinaryOperators: false
+BreakConstructorInitializers: BeforeColon
+BreakBeforeBinaryOperators: None
 BreakBeforeTernaryOperators: false
-AlwaysBreakTemplateDeclarations: true
-AllowShortIfStatementsOnASingleLine: false
-AllowShortBlocksOnASingleLine: false
+AlwaysBreakTemplateDeclarations: Yes
+AllowShortIfStatementsOnASingleLine: Never
+AllowShortBlocksOnASingleLine: Never
 AllowShortCaseLabelsOnASingleLine: true
-AllowShortFunctionsOnASingleLine: false
+AllowShortFunctionsOnASingleLine: Empty
 AllowShortLoopsOnASingleLine: false
 Cpp11BracedListStyle: true
 IndentCaseLabels: false

.editorconfig

@@ -1,7 +1,7 @@
 root = true
 
 [*.{h,cpp,hpp}]
-charset = utf-8-bom
+charset = utf-8
 indent_style = tab
 indent_size = 4
 trim_trailing_whitespace = true

.gdbinit

@@ -0,0 +1,2 @@
+handle SIGSEGV nostop noprint
+handle SIGPIPE nostop noprint

.github/ISSUE_TEMPLATE/1-regression-report.md

@@ -1,28 +1,62 @@
 ---
 name: Regression report
-about: If something worked before, but now it doesn't
+about: If something used to work before, but now it doesn't
 title: ''
 labels: ''
 assignees: ''
 
 ---
 
-<!---
-Please do not ask for help or report compatibility regressions here, use RPCS3 Discord server or forums instead.
-
-Please read Contributing guide under Helpful resources on the right. →
---->
+## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
 
 ## Quick summary
-Please describe what exactly has stopped working correctly
+Please briefly describe what has stopped working correctly.
 
 ## Details
-Please provide _exact_ build (or commit) information that introduced the regression you're reporting.
-Please see How to find the build that caused a regression in wiki: https://wiki.rpcs3.net/index.php?title=Help:Using_different_versions_of_RPCS3#How_to_find_the_build_that_caused_a_regression.3F
-You can find old builds here: https://rpcs3.net/compatibility?b
+Please describe the regression as accurately as possible.
 
-Please remember to attach TWO logs: one for the build that exhibits regression, and one for the previous build that works as expected.
+#### 1. Please provide _exact_ build (or commit) information that introduced the regression you're reporting.
+* Please see [How to find the build that caused a regression](https://wiki.rpcs3.net/index.php?title=Help:Using_different_versions_of_RPCS3#How_to_find_the_build_that_caused_a_regression.3F) in our wiki.
+* You can find [History of RPCS3 builds](https://rpcs3.net/compatibility?b) here.
 
-If the regression caused a graphical issue, please provide RSX capture and a Renderdoc capture that demonstrate the issue.
-To create an RSX capture, enable Debugger view (View → Show Debugger) and use the RSX Capture button. Captues will be stored in RPCS3 folder → captures.
-To create Renderdoc capture, please refer to Renderdoc documentation https://renderdoc.org/docs/how/how_capture_frame.html
+#### 2. Please attach TWO logs:
+* One for the build with regression.
+* One for the build that works as expected.
+
+##### How to obtain RPCS3's log:
+* Run the game until you find the regression.
+* Completely close RPCS3, or move to the next step in case it has crashed.
+* Locate RPCS3's log file:
+	+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
+	or
+	+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
+![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
+	On Linux it will be in ```~/.cache/rpcs3/```.
+	On Windows it will be near the executable.
+* Attach the log:
+	+ Drag and drop your log file into the issue.
+	+ Or upload it to the cloud, such as Dropbox, Mega etc. 
+
+#### 3. If you describe graphical regression, please provide an RSX capture and a RenderDoc capture that demonstrate it.
+* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
+Captures will be stored in RPCS3 folder → captures.
+	+ Compress your capture with 7z, Rar etc. 
+	And drag and drop it into the issue.
+	+ Or upload it to the cloud, such as Dropbox, Mega etc.
+* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
+
+#### 4. Please attach screenshots of your problem.
+* Enable performance overlay with at least medium level of detail.
+You can find it in _Emulator_ tab in _Settings_.
+
+#### 5. Please provide comparison with real PS3.
+
+#### 6. Please provide your system configuration:
+* OS
+* CPU
+* GPU
+* Driver version
+* etc.
+
+#### Please include.
+* Anything else you deem to be important

.github/ISSUE_TEMPLATE/2-bug-report.md

@@ -7,20 +7,49 @@ assignees: ''
 
 ---
 
-<!---
-Please do not ask for help or general inquiry here, use RPCS3 Discord server instead.
-
-Please read Contributing guide under Helpful resources on the right. →
---->
+## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
 
 ## Quick summary
-Please summarize the issue here
+Please briefly describe what is not working correctly.
 
 ## Details
-Please provide as much detail as you can here, including
-- expected (real hw) and observed (emulator) behavior
-- full logs (not from UI)
-- back traces (for hard crashes)
-- screenshots, Renderdoc, and RSX captures (for visual issues)
-- your system configuration (OS, CPU, GPU, driver versions, etc)
-- anything else you deem to be important
+
+Please describe the problem as accurately as possible.
+
+#### 1. Please attach RPCS3's log.
+* Run the game until you find the issue.
+* Completely close RPCS3, or move to the next step in case it has crashed.
+* Locate RPCS3's log file:
+	+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
+	or
+	+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
+![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
+	On Linux it will be in ```~/.cache/rpcs3/```.
+	On Windows it will be near the executable.
+* Attach the log:
+	+ Drag and drop your log file into the issue.
+	+ Or upload it to the cloud, such as Dropbox, Mega etc. 
+
+#### 2. If you describe graphical issue, please provide an RSX capture and a RenderDoc capture that demonstrate it.
+* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
+Captures will be stored in RPCS3 folder → captures.
+	+ Compress your capture with 7z, Rar etc. 
+	And	drag and drop it into the issue.
+	+ Or upload it to the cloud, such as Dropbox, Mega etc.
+* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
+
+#### 3. Please attach screenshots of your problem.
+* Enable performance overlay with at least medium level of detail.
+You can find it in _Emulator_ tab in _Settings_.
+
+#### 4. Please provide comparison with real PS3.
+
+#### 5. Please provide your system configuration:
+* OS
+* CPU
+* GPU
+* Driver version
+* etc.
+
+#### Please include.
+* Anything else you deem to be important

.github/ISSUE_TEMPLATE/3-feature-request.md

@@ -0,0 +1,41 @@
+---
+name: Feature Request
+about: If RPCS3 lacks a feature you would like to see
+title: '[Feature Request] Enter Feature Title Here'
+labels: ''
+assignees: ''
+
+---
+
+## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
+
+## Quick summary
+Please briefly describe what feature you would like RPCS3 to have.
+
+## Details
+
+Please describe the feature as accurately as possible.
+
+#### 1. Please describe, what part of RPCS3 would be affected by your feature:
+* Gameplay
+* Debugging
+* UI
+* Patches
+* Installation
+* Github
+* CI
+* etc.
+
+#### 2. Please tell us, why your feature is important to RPCS3.
+
+#### 3. Please attach screenshots of the feature implemented in other projects.
+
+#### 4. Please provide your system configuration:
+* OS
+* CPU
+* GPU
+* Driver version
+* etc.
+
+#### Please include.
+* Anything else you deem to be important

.github/PR-BUILD.md

@@ -0,0 +1,20 @@
+## How to test a PR build
+
+Please take into account, that RPCS3 build usually takes some time (about 20 min), so you can't access a build, if a PR was just submitted.
+
+- Open a PR you want to test
+- Scroll to the very bottom and locate "Checks" section
+- Expand all checks
+	You are supposed to see something like this
+	![image](https://user-images.githubusercontent.com/44116740/102790039-f98f6d00-43b5-11eb-9134-2359b732508d.png)
+- Click on **Linux_Build** or **Windows_Build** __Details__
+- Click **View more details on Azure Pipelines** at the very bottom
+	![image](https://user-images.githubusercontent.com/44116740/102790281-45daad00-43b6-11eb-90e7-0fa8c37c31c6.png)
+- Click on *1 artifact produced*
+	![image](https://user-images.githubusercontent.com/44116740/102790526-9a7e2800-43b6-11eb-9925-be1ea1c8bdad.png)
+- Select a build for your OS and click three dots on the right, Click **Download artifacts**
+	![image](https://user-images.githubusercontent.com/44116740/102790636-c9949980-43b6-11eb-9692-1e3ba567b9be.png)
+	
+- Congratulations! You are now downloading RPCS3 build for specific PR.
+
+Please note, that PR builds are not supposed to be stable, because they contain new changesets. 

.github/PULL_REQUEST_TEMPLATE/1-default.md

@@ -0,0 +1,3 @@
+<!-- Please include a summary of the change and which issue is fixed. -->
+
+[How to test this PR](.github/PR-BUILD.md)

.gitignore

@@ -40,6 +40,7 @@
 /3rdparty/llvm_build
 /Vulkan/Vulkan-build
 /Vulkan/glslang-build
+/Vulkan/spirv-tools-build
 
 !/bin
 /bin/*

.gitmodules

@@ -14,6 +14,14 @@
 	path = Vulkan/glslang
 	url = https://github.com/KhronosGroup/glslang.git
 	ignore = dirty
+[submodule "Vulkan/spirv-tools"]
+	path = Vulkan/spirv-tools
+	url = https://github.com/KhronosGroup/SPIRV-Tools.git
+	ignore = dirty
+[submodule "Vulkan/spirv-headers"]
+	path = Vulkan/spirv-headers
+	url = https://github.com/KhronosGroup/SPIRV-Headers.git
+	ignore = dirty
 [submodule "3rdparty/cereal"]
 	path = 3rdparty/cereal
 	url = https://github.com/RPCS3/cereal.git
@@ -57,10 +65,13 @@
 	ignore = dirty
 [submodule "3rdparty/curl"]
 	path = 3rdparty/curl
-	url = https://github.com/RipleyTom/curl.git
+	url = https://github.com/curl/curl.git
 	ignore = dirty
 [submodule "3rdparty/wolfssl"]
 	path = 3rdparty/wolfssl
-	url = https://github.com/RipleyTom/wolfssl.git
+	url = https://github.com/wolfSSL/wolfssl.git
+	ignore = dirty
+[submodule "3rdparty/flatbuffers"]
+	path = 3rdparty/flatbuffers
+	url = https://github.com/google/flatbuffers.git
 	ignore = dirty
-

.mention-bot

@@ -1,3 +0,0 @@
-{
-  "userBlacklist": ["AlexAltea", "tambry", "DHrpcs3"]
-}

.travis.yml

@@ -1,41 +0,0 @@
-language: cpp
-jobs:
-    include:
-        - os: linux
-          dist: xenial
-          env:
-            - NAME="Linux build"
-            - COMPILER="gcc"
-            - DEPLOY_APPIMAGE="true"
-          services: docker
-          cache: ccache
-          compiler: gcc
-          install: "docker pull rpcs3/rpcs3-travis-xenial:1.2"
-          script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.2 /rpcs3/.ci/build-linux.sh'
-        - os: linux
-          dist: xenial
-          env:
-            - NAME="Linux build"
-            - COMPILER="clang"
-          services: docker
-          cache: ccache
-          compiler: clang
-          install: "docker pull rpcs3/rpcs3-travis-xenial:1.2"
-          script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.2 /rpcs3/.ci/build-linux.sh'
-        # - os: osx
-        #   osx_image: xcode11.3
-        #   addons:
-        #     homebrew:
-        #         packages:
-        #             - ccache
-        #             - glew
-        #             - ninja
-        #             - qt
-        #   script: "/bin/bash -ex .ci/build-mac.sh"
-        #   cache: ccache
-    allow_failures:
-        - os: osx
-
-git:
-  depth: false # Unshallow clone to obtain proper GIT_VERSION
-  submodules: false

3rdparty/7zlib.vcxproj

@@ -111,6 +111,9 @@
   </PropertyGroup>
   <Import Project="..\common_default.props" />
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <Import Project="..\common_default_macros.props" />
   <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|Win32'" Label="Configuration">
     <ConfigurationType>StaticLibrary</ConfigurationType>

3rdparty/CMakeLists.txt

@@ -74,6 +74,9 @@ else()
 	add_library(3rdparty_7z INTERFACE)
 endif()
 
+add_library(3rdparty_flatbuffers INTERFACE)
+target_include_directories(3rdparty_flatbuffers INTERFACE flatbuffers/include)
+
 # libPNG
 # Select the version of libpng to use, default is builtin
 if (NOT USE_SYSTEM_LIBPNG)
@@ -103,6 +106,36 @@ endif()
 add_subdirectory(pugixml EXCLUDE_FROM_ALL)
 
 
+# libusb
+if(CMAKE_SYSTEM MATCHES "DragonFly|FreeBSD")
+	pkg_check_modules(LIBUSB REQUIRED IMPORTED_TARGET libusb-1.0>=1.0 )
+	CMAKE_DEPENDENT_OPTION( USE_SYS_LIBUSB "Use system libusb-1.0 as shared library" ON
+			"LIBUSB_FOUND" OFF)
+else()
+	pkg_check_modules(LIBUSB IMPORTED_TARGET libusb-1.0>=1.0 )
+	CMAKE_DEPENDENT_OPTION( USE_SYS_LIBUSB "Use system libusb-1.0 as shared library" OFF
+			"LIBUSB_FOUND" OFF)
+endif()
+if(CMAKE_SYSTEM MATCHES "DragonFly|FreeBSD")
+	# Always use system libusb as reference implementation isn't supported
+	add_library(usb-1.0-shared INTERFACE)
+	target_link_libraries(usb-1.0-shared INTERFACE PkgConfig::LIBUSB)
+elseif(MSVC)
+	# Windows time.h defines timespec but doesn't add any flag for it, which makes libusb attempt to define it again
+	add_definitions(-DHAVE_STRUCT_TIMESPEC=1)
+	add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
+else()
+	if(USE_SYS_LIBUSB)
+		# we have the system libusb and have selected to use it
+		add_library(usb-1.0-shared INTERFACE)
+		target_link_libraries(usb-1.0-shared INTERFACE PkgConfig::LIBUSB)
+	else()
+		# we don't have the system libusb, so we compile from submodule
+		add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
+	endif()
+endif()
+
+
 # hidapi
 add_library(3rdparty_hidapi INTERFACE)
 target_include_directories(3rdparty_hidapi INTERFACE hidapi/hidapi)
@@ -130,24 +163,11 @@ else()
 endif()
 
 
-# libusb
-if(CMAKE_SYSTEM MATCHES "DragonFly|FreeBSD")
-	# Always use system libusb as reference implementation isn't supported
-	add_library(usb-1.0-static INTERFACE)
-	target_link_libraries(usb-1.0-static INTERFACE usb)
-elseif(MSVC)
-	# Windows time.h defines timespec but doesn't add any flag for it, which makes libusb attempt to define it again
-	add_definitions(-DHAVE_STRUCT_TIMESPEC=1)
-	add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
-else()
-	add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
-endif()
-
-
 # yaml-cpp
 # We don't want to install yaml-cpp but its cmake file doesn't have option
 # to disable it...
 # So we just install it to a different directory
+set(YAML_CPP_INSTALL OFF CACHE BOOL "Don't install YAML")
 set(CMAKE_INSTALL_PREFIX_OLD ${CMAKE_INSTALL_PREFIX})
 set(CMAKE_INSTALL_PREFIX ${CMAKE_BINARY_DIR}/yaml-cpp_install)
 
@@ -161,6 +181,7 @@ set(CMAKE_INSTALL_PREFIX ${CMAKE_INSTALL_PREFIX_OLD})
 
 # xxHash
 set(XXHASH_BUNDLED_MODE ON)
+set(XXHASH_BUILD_XXHSUM OFF)
 set(BUILD_SHARED_LIBS OFF CACHE BOOL "Make xxHash build static libs")
 add_subdirectory(xxHash/cmake_unofficial EXCLUDE_FROM_ALL)
 target_include_directories(xxhash INTERFACE xxHash)
@@ -297,7 +318,7 @@ if(USE_VULKAN)
 	if(VULKAN_FOUND)
 		add_library(3rdparty_vulkan INTERFACE)
 		target_compile_definitions(3rdparty_vulkan INTERFACE -DHAVE_VULKAN)
-		target_link_libraries(3rdparty_vulkan INTERFACE SPIRV Vulkan::Vulkan)
+		target_link_libraries(3rdparty_vulkan INTERFACE SPIRV SPIRV-Tools-opt Vulkan::Vulkan)
 
 		if(UNIX AND NOT APPLE)
 			find_package(Wayland)
@@ -413,23 +434,57 @@ endif()
 # LLVM
 include(llvm.cmake)
 
+# WOLFSSL
+if(USE_SYSTEM_WOLFSSL)
+	message("-- RPCS3: using shared wolfssl")
+	find_package(WolfSSL REQUIRED)
+	add_library(wolfssl INTERFACE)
+	target_link_libraries(wolfssl INTERFACE WolfSSL_LIBRARIES)
+	target_include_directories(wolfssl INTERFACE WolfSSL_INCLUDE_DIRS)
+else()
+	SET(BUILD_TESTS NO CACHE BOOL "Build test applications")
+	add_compile_definitions(HAVE_FFDHE_2048 TFM_TIMING_RESISTANT ECC_TIMING_RESISTANT
+					WC_RSA_BLINDING HAVE_AESGCM WOLFSSL_SHA512 WOLFSSL_SHA384 NO_DSA HAVE_ECC TFM_ECC256 ECC_SHAMIR
+					NO_RC4 NO_HC128 NO_RABBIT WOLFSSL_SHA224 WOLFSSL_SHA3 WOLFSSL_SHAKE256 HAVE_POLY1305
+					HAVE_ONE_TIME_AUTH HAVE_CHACHA HAVE_HASHDRBG HAVE_TLS_EXTENSIONS HAVE_SNI HAVE_SUPPORTED_CURVES
+					HAVE_EXTENDED_MASTER NO_RC4 HAVE_ENCRYPT_THEN_MAC NO_PSK NO_MD4
+					WC_NO_ASYNC_THREADING OPENSSL_EXTRA WOLFSSL_DES_ECB WC_NO_HARDEN)
+	set(ENABLED_HARDEN OFF CACHE BOOL "Disable Harden")
+	add_subdirectory(wolfssl EXCLUDE_FROM_ALL)
+	target_include_directories(wolfssl INTERFACE "wolfssl/")
+	# This is needed for CURL
+	configure_file(${CMAKE_CURRENT_SOURCE_DIR}/wolfssl/wolfssl/options.h.in ${CMAKE_CURRENT_BINARY_DIR}/wolfssl/wolfssl/options.h)
+	set(WolfSSL_LIBRARY "${CMAKE_CURRENT_BINARY_DIR}/wolfssl/libwolfssl.a")
+	set(WolfSSL_LIBRARIES "${CMAKE_CURRENT_BINARY_DIR}/wolfssl/libwolfssl.a")
+	set(WolfSSL_INCLUDE_DIR "${CMAKE_CURRENT_SOURCE_DIR}/wolfssl/" "${CMAKE_CURRENT_BINARY_DIR}/wolfssl/")
+	set(WolfSSL_INCLUDE_DIRS "${CMAKE_CURRENT_SOURCE_DIR}/wolfssl/" "${CMAKE_CURRENT_BINARY_DIR}/wolfssl/")
+endif()
+
 # CURL
 if(USE_SYSTEM_CURL)
 	message("-- RPCS3: using shared libcurl")
 	find_package(CURL REQUIRED)
-	add_library(wolfssl-3-static INTERFACE)
 	add_library(libcurl INTERFACE)
 	target_link_libraries(libcurl INTERFACE CURL::libcurl)
 else()
 	message("-- RPCS3: building libcurl + wolfssl submodules")
-	add_subdirectory(wolfssl EXCLUDE_FROM_ALL)
+	option(BUILD_CURL_EXE "Set to ON to build curl executable." OFF)
+	option(CMAKE_USE_WOLFSSL "enable wolfSSL for SSL/TLS" ON)
+	option(HTTP_ONLY "disables all protocols except HTTP (This overrides all CURL_DISABLE_* options)" ON)
+	option(CURL_ZLIB "Set to ON to enable building curl with zlib support." OFF)
+	set(CURL_CA_PATH "none" CACHE STRING "Location of default CA path. Set 'none' to disable or 'auto' for auto-detection. Defaults to 'auto'.")
 	add_subdirectory(curl EXCLUDE_FROM_ALL)
 endif()
 
 # add nice ALIAS targets for ease of use
-add_library(3rdparty::libusb ALIAS usb-1.0-static)
+if(USE_SYS_LIBUSB)
+	add_library(3rdparty::libusb ALIAS usb-1.0-shared)
+else()
+	add_library(3rdparty::libusb ALIAS usb-1.0-static)
+endif()
 add_library(3rdparty::zlib ALIAS 3rdparty_zlib)
 add_library(3rdparty::7z ALIAS 3rdparty_7z)
+add_library(3rdparty::flatbuffers ALIAS 3rdparty_flatbuffers)
 add_library(3rdparty::pugixml ALIAS pugixml)
 add_library(3rdparty::yaml-cpp ALIAS yaml-cpp)
 add_library(3rdparty::xxhash ALIAS xxhash)
@@ -448,5 +503,5 @@ add_library(3rdparty::vulkan ALIAS ${VULKAN_TARGET})
 add_library(3rdparty::openal ALIAS 3rdparty_openal)
 add_library(3rdparty::ffmpeg ALIAS 3rdparty_ffmpeg)
 add_library(3rdparty::glew ALIAS 3rdparty_glew)
-add_library(3rdparty::wolfssl ALIAS wolfssl-3-static)
+add_library(3rdparty::wolfssl ALIAS wolfssl)
 add_library(3rdparty::libcurl ALIAS libcurl)

3rdparty/GL/glext.h

@@ -1,12 +1,12 @@
-#ifndef __glext_h_
-#define __glext_h_ 1
+#ifndef __gl_glext_h_
+#define __gl_glext_h_ 1
 
 #ifdef __cplusplus
 extern "C" {
 #endif
 
 /*
-** Copyright (c) 2013-2017 The Khronos Group Inc.
+** Copyright (c) 2013-2018 The Khronos Group Inc.
 **
 ** Permission is hereby granted, free of charge, to any person obtaining a
 ** copy of this software and/or associated documentation files (the
@@ -51,7 +51,9 @@ extern "C" {
 #define GLAPI extern
 #endif
 
-#define GL_GLEXT_VERSION 20180114
+#define GL_GLEXT_VERSION 20200423
+
+#include "khrplatform.h"
 
 /* Generated C header for:
  * API: gl
@@ -464,9 +466,8 @@ GLAPI void APIENTRY glBlendEquation (GLenum mode);
 
 #ifndef GL_VERSION_1_5
 #define GL_VERSION_1_5 1
-#include <stddef.h>
-typedef ptrdiff_t GLsizeiptr;
-typedef ptrdiff_t GLintptr;
+typedef khronos_ssize_t GLsizeiptr;
+typedef khronos_intptr_t GLintptr;
 #define GL_BUFFER_SIZE                    0x8764
 #define GL_BUFFER_USAGE                   0x8765
 #define GL_QUERY_COUNTER_BITS             0x8864
@@ -879,7 +880,7 @@ GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboole
 
 #ifndef GL_VERSION_3_0
 #define GL_VERSION_3_0 1
-typedef unsigned short GLhalf;
+typedef khronos_uint16_t GLhalf;
 #define GL_COMPARE_REF_TO_TEXTURE         0x884E
 #define GL_CLIP_DISTANCE0                 0x3000
 #define GL_CLIP_DISTANCE1                 0x3001
@@ -1383,45 +1384,8 @@ GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIn
 #ifndef GL_VERSION_3_2
 #define GL_VERSION_3_2 1
 typedef struct __GLsync *GLsync;
-#ifndef GLEXT_64_TYPES_DEFINED
-/* This code block is duplicated in glxext.h, so must be protected */
-#define GLEXT_64_TYPES_DEFINED
-/* Define int32_t, int64_t, and uint64_t types for UST/MSC */
-/* (as used in the GL_EXT_timer_query extension). */
-#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L
-#include <inttypes.h>
-#elif defined(__sun__) || defined(__digital__)
-#include <inttypes.h>
-#if defined(__STDC__)
-#if defined(__arch64__) || defined(_LP64)
-typedef long int int64_t;
-typedef unsigned long int uint64_t;
-#else
-typedef long long int int64_t;
-typedef unsigned long long int uint64_t;
-#endif /* __arch64__ */
-#endif /* __STDC__ */
-#elif defined( __VMS ) || defined(__sgi)
-#include <inttypes.h>
-#elif defined(__SCO__) || defined(__USLC__)
-#include <stdint.h>
-#elif defined(__UNIXOS2__) || defined(__SOL64__)
-typedef long int int32_t;
-typedef long long int int64_t;
-typedef unsigned long long int uint64_t;
-#elif defined(_WIN32) && defined(__GNUC__)
-#include <stdint.h>
-#elif defined(_WIN32)
-typedef __int32 int32_t;
-typedef __int64 int64_t;
-typedef unsigned __int64 uint64_t;
-#else
-/* Fallback if nothing above works */
-#include <inttypes.h>
-#endif
-#endif
-typedef uint64_t GLuint64;
-typedef int64_t GLint64;
+typedef khronos_uint64_t GLuint64;
+typedef khronos_int64_t GLint64;
 #define GL_CONTEXT_CORE_PROFILE_BIT       0x00000001
 #define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002
 #define GL_LINES_ADJACENCY                0x000A
@@ -1497,7 +1461,7 @@ typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync);
 typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
 typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
 typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data);
-typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
+typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
 typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data);
 typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params);
 typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1517,7 +1481,7 @@ GLAPI void APIENTRY glDeleteSync (GLsync sync);
 GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
 GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
 GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data);
-GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
+GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
 GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data);
 GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params);
 GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1773,8 +1737,8 @@ typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location,
 typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name);
 typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name);
 typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
-typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
-typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
+typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
+typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
 typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices);
 typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params);
 typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -1820,8 +1784,8 @@ GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *pa
 GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name);
 GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name);
 GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
-GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
-GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
+GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
+GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
 GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices);
 GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params);
 GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -2175,7 +2139,7 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data)
 typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
 typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
 typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
-typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params);
+typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
 typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
 typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
 typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers);
@@ -2188,7 +2152,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m
 GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
 GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
 GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
-GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params);
+GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
 GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
 GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
 GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers);
@@ -2469,7 +2433,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect);
 typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
 typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param);
 typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
-typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params);
+typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
 typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
 typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level);
 typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2481,7 +2445,7 @@ typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum
 typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
 typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
 typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
-typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
 typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name);
 typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
 typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2513,7 +2477,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect);
 GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
 GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param);
 GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params);
-GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params);
+GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
 GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
 GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level);
 GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2525,7 +2489,7 @@ GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const
 GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
 GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name);
 GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
-GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params);
+GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
 GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name);
 GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name);
 GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2936,7 +2900,7 @@ GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLflo
 
 #ifndef GL_ARB_bindless_texture
 #define GL_ARB_bindless_texture 1
-typedef uint64_t GLuint64EXT;
+typedef khronos_uint64_t GLuint64EXT;
 #define GL_UNSIGNED_INT64_ARB             0x140F
 typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture);
 typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler);
@@ -3496,7 +3460,7 @@ GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, G
 
 #ifndef GL_ARB_half_float_pixel
 #define GL_ARB_half_float_pixel 1
-typedef unsigned short GLhalfARB;
+typedef khronos_uint16_t GLhalfARB;
 #define GL_HALF_FLOAT_ARB                 0x140B
 #endif /* GL_ARB_half_float_pixel */
 
@@ -3666,6 +3630,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor);
 #ifndef GL_ARB_internalformat_query2
 #define GL_ARB_internalformat_query2 1
 #define GL_SRGB_DECODE_ARB                0x8299
+#define GL_VIEW_CLASS_EAC_R11             0x9383
+#define GL_VIEW_CLASS_EAC_RG11            0x9384
+#define GL_VIEW_CLASS_ETC2_RGB            0x9385
+#define GL_VIEW_CLASS_ETC2_RGBA           0x9386
+#define GL_VIEW_CLASS_ETC2_EAC_RGBA       0x9387
+#define GL_VIEW_CLASS_ASTC_4x4_RGBA       0x9388
+#define GL_VIEW_CLASS_ASTC_5x4_RGBA       0x9389
+#define GL_VIEW_CLASS_ASTC_5x5_RGBA       0x938A
+#define GL_VIEW_CLASS_ASTC_6x5_RGBA       0x938B
+#define GL_VIEW_CLASS_ASTC_6x6_RGBA       0x938C
+#define GL_VIEW_CLASS_ASTC_8x5_RGBA       0x938D
+#define GL_VIEW_CLASS_ASTC_8x6_RGBA       0x938E
+#define GL_VIEW_CLASS_ASTC_8x8_RGBA       0x938F
+#define GL_VIEW_CLASS_ASTC_10x5_RGBA      0x9390
+#define GL_VIEW_CLASS_ASTC_10x6_RGBA      0x9391
+#define GL_VIEW_CLASS_ASTC_10x8_RGBA      0x9392
+#define GL_VIEW_CLASS_ASTC_10x10_RGBA     0x9393
+#define GL_VIEW_CLASS_ASTC_12x10_RGBA     0x9394
+#define GL_VIEW_CLASS_ASTC_12x12_RGBA     0x9395
 #endif /* GL_ARB_internalformat_query2 */
 
 #ifndef GL_ARB_invalidate_subdata
@@ -4713,8 +4696,8 @@ GLAPI void APIENTRY glVertexBlendARB (GLint count);
 
 #ifndef GL_ARB_vertex_buffer_object
 #define GL_ARB_vertex_buffer_object 1
-typedef ptrdiff_t GLsizeiptrARB;
-typedef ptrdiff_t GLintptrARB;
+typedef khronos_ssize_t GLsizeiptrARB;
+typedef khronos_intptr_t GLintptrARB;
 #define GL_BUFFER_SIZE_ARB                0x8764
 #define GL_BUFFER_USAGE_ARB               0x8765
 #define GL_ARRAY_BUFFER_ARB               0x8892
@@ -4909,6 +4892,12 @@ GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcha
 
 #ifndef GL_ARB_viewport_array
 #define GL_ARB_viewport_array 1
+typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYDVNVPROC) (GLuint first, GLsizei count, const GLdouble *v);
+typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDDNVPROC) (GLuint index, GLdouble n, GLdouble f);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDepthRangeArraydvNV (GLuint first, GLsizei count, const GLdouble *v);
+GLAPI void APIENTRY glDepthRangeIndexeddNV (GLuint index, GLdouble n, GLdouble f);
+#endif
 #endif /* GL_ARB_viewport_array */
 
 #ifndef GL_ARB_window_pos
@@ -5009,6 +4998,22 @@ GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count);
 #define GL_CONTEXT_ROBUST_ACCESS          0x90F3
 #endif /* GL_KHR_robustness */
 
+#ifndef GL_KHR_shader_subgroup
+#define GL_KHR_shader_subgroup 1
+#define GL_SUBGROUP_SIZE_KHR              0x9532
+#define GL_SUBGROUP_SUPPORTED_STAGES_KHR  0x9533
+#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534
+#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR   0x9535
+#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001
+#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR  0x00000002
+#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004
+#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008
+#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010
+#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020
+#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040
+#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR  0x00000080
+#endif /* GL_KHR_shader_subgroup */
+
 #ifndef GL_KHR_texture_compression_astc_hdr
 #define GL_KHR_texture_compression_astc_hdr 1
 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR   0x93B0
@@ -5115,7 +5120,7 @@ GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords);
 
 #ifndef GL_OES_fixed_point
 #define GL_OES_fixed_point 1
-typedef GLint GLfixed;
+typedef khronos_int32_t GLfixed;
 #define GL_FIXED_OES                      0x140C
 typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref);
 typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha);
@@ -5411,12 +5416,12 @@ typedef void (APIENTRY  *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severi
 typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
 typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
 typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam);
-typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
+typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
 #ifdef GL_GLEXT_PROTOTYPES
 GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
 GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
 GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam);
-GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
+GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
 #endif
 #endif /* GL_AMD_debug_output */
 
@@ -5440,6 +5445,22 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG
 #endif
 #endif /* GL_AMD_draw_buffers_blend */
 
+#ifndef GL_AMD_framebuffer_multisample_advanced
+#define GL_AMD_framebuffer_multisample_advanced 1
+#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2
+#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3
+#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4
+#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5
+#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6
+#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7
+typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
+GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
+#endif
+#endif /* GL_AMD_framebuffer_multisample_advanced */
+
 #ifndef GL_AMD_framebuffer_sample_positions
 #define GL_AMD_framebuffer_sample_positions 1
 #define GL_SUBSAMPLE_DISTANCE_AMD         0x883F
@@ -5485,7 +5506,7 @@ GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLe
 
 #ifndef GL_AMD_gpu_shader_int64
 #define GL_AMD_gpu_shader_int64 1
-typedef int64_t GLint64EXT;
+typedef khronos_int64_t GLint64EXT;
 #define GL_INT64_NV                       0x140E
 #define GL_UNSIGNED_INT64_NV              0x140F
 #define GL_INT8_NV                        0x8FE0
@@ -5704,6 +5725,10 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf
 #define GL_AMD_shader_explicit_vertex_parameter 1
 #endif /* GL_AMD_shader_explicit_vertex_parameter */
 
+#ifndef GL_AMD_shader_gpu_shader_half_float_fetch
+#define GL_AMD_shader_gpu_shader_half_float_fetch 1
+#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */
+
 #ifndef GL_AMD_shader_image_load_store_lod
 #define GL_AMD_shader_image_load_store_lod 1
 #endif /* GL_AMD_shader_image_load_store_lod */
@@ -6451,6 +6476,21 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param);
 #define GL_422_REV_AVERAGE_EXT            0x80CF
 #endif /* GL_EXT_422_pixels */
 
+#ifndef GL_EXT_EGL_image_storage
+#define GL_EXT_EGL_image_storage 1
+typedef void *GLeglImageOES;
+typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list);
+typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list);
+GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
+#endif
+#endif /* GL_EXT_EGL_image_storage */
+
+#ifndef GL_EXT_EGL_sync
+#define GL_EXT_EGL_sync 1
+#endif /* GL_EXT_EGL_sync */
+
 #ifndef GL_EXT_abgr
 #define GL_EXT_abgr 1
 #define GL_ABGR_EXT                       0x8000
@@ -7780,6 +7820,18 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern);
 #endif
 #endif /* GL_EXT_multisample */
 
+#ifndef GL_EXT_multiview_tessellation_geometry_shader
+#define GL_EXT_multiview_tessellation_geometry_shader 1
+#endif /* GL_EXT_multiview_tessellation_geometry_shader */
+
+#ifndef GL_EXT_multiview_texture_multisample
+#define GL_EXT_multiview_texture_multisample 1
+#endif /* GL_EXT_multiview_texture_multisample */
+
+#ifndef GL_EXT_multiview_timer_query
+#define GL_EXT_multiview_timer_query 1
+#endif /* GL_EXT_multiview_timer_query */
+
 #ifndef GL_EXT_packed_depth_stencil
 #define GL_EXT_packed_depth_stencil 1
 #define GL_DEPTH_STENCIL_EXT              0x84F9
@@ -8049,6 +8101,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin
 #define GL_SEPARATE_SPECULAR_COLOR_EXT    0x81FA
 #endif /* GL_EXT_separate_specular_color */
 
+#ifndef GL_EXT_shader_framebuffer_fetch
+#define GL_EXT_shader_framebuffer_fetch 1
+#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52
+#endif /* GL_EXT_shader_framebuffer_fetch */
+
+#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent
+#define GL_EXT_shader_framebuffer_fetch_non_coherent 1
+typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void);
+#endif
+#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */
+
 #ifndef GL_EXT_shader_image_load_formatted
 #define GL_EXT_shader_image_load_formatted 1
 #endif /* GL_EXT_shader_image_load_formatted */
@@ -8485,6 +8550,11 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
 #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F
 #endif /* GL_EXT_texture_sRGB */
 
+#ifndef GL_EXT_texture_sRGB_R8
+#define GL_EXT_texture_sRGB_R8 1
+#define GL_SR8_EXT                        0x8FBD
+#endif /* GL_EXT_texture_sRGB_R8 */
+
 #ifndef GL_EXT_texture_sRGB_decode
 #define GL_EXT_texture_sRGB_decode 1
 #define GL_TEXTURE_SRGB_DECODE_EXT        0x8A48
@@ -8492,6 +8562,10 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
 #define GL_SKIP_DECODE_EXT                0x8A4A
 #endif /* GL_EXT_texture_sRGB_decode */
 
+#ifndef GL_EXT_texture_shadow_lod
+#define GL_EXT_texture_shadow_lod 1
+#endif /* GL_EXT_texture_shadow_lod */
+
 #ifndef GL_EXT_texture_shared_exponent
 #define GL_EXT_texture_shared_exponent 1
 #define GL_RGB9_E5_EXT                    0x8C3D
@@ -9098,6 +9172,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG
 #define GL_INTERLACE_READ_INGR            0x8568
 #endif /* GL_INGR_interlace_read */
 
+#ifndef GL_INTEL_blackhole_render
+#define GL_INTEL_blackhole_render 1
+#define GL_BLACKHOLE_RENDER_INTEL         0x83FC
+#endif /* GL_INTEL_blackhole_render */
+
 #ifndef GL_INTEL_conservative_rasterization
 #define GL_INTEL_conservative_rasterization 1
 #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE
@@ -9206,6 +9285,27 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen
 #define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E
 #endif /* GL_MESAX_texture_stack */
 
+#ifndef GL_MESA_framebuffer_flip_x
+#define GL_MESA_framebuffer_flip_x 1
+#define GL_FRAMEBUFFER_FLIP_X_MESA        0x8BBC
+#endif /* GL_MESA_framebuffer_flip_x */
+
+#ifndef GL_MESA_framebuffer_flip_y
+#define GL_MESA_framebuffer_flip_y 1
+#define GL_FRAMEBUFFER_FLIP_Y_MESA        0x8BBB
+typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param);
+typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param);
+GLAPI void APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params);
+#endif
+#endif /* GL_MESA_framebuffer_flip_y */
+
+#ifndef GL_MESA_framebuffer_swap_xy
+#define GL_MESA_framebuffer_swap_xy 1
+#define GL_FRAMEBUFFER_SWAP_XY_MESA       0x8BBD
+#endif /* GL_MESA_framebuffer_swap_xy */
+
 #ifndef GL_MESA_pack_invert
 #define GL_MESA_pack_invert 1
 #define GL_PACK_INVERT_MESA               0x8758
@@ -9319,6 +9419,25 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void);
 #define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B
 #endif /* GL_NVX_gpu_memory_info */
 
+#ifndef GL_NVX_gpu_multicast2
+#define GL_NVX_gpu_multicast2 1
+#define GL_UPLOAD_GPU_MASK_NVX            0x954A
+typedef void (APIENTRYP PFNGLUPLOADGPUMASKNVXPROC) (GLbitfield mask);
+typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
+typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTPOSITIONWSCALENVXPROC) (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
+typedef void (APIENTRYP PFNGLMULTICASTSCISSORARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
+typedef GLuint (APIENTRYP PFNGLASYNCCOPYBUFFERSUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
+typedef GLuint (APIENTRYP PFNGLASYNCCOPYIMAGESUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glUploadGpuMaskNVX (GLbitfield mask);
+GLAPI void APIENTRY glMulticastViewportArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
+GLAPI void APIENTRY glMulticastViewportPositionWScaleNVX (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
+GLAPI void APIENTRY glMulticastScissorArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
+GLAPI GLuint APIENTRY glAsyncCopyBufferSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
+GLAPI GLuint APIENTRY glAsyncCopyImageSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
+#endif
+#endif /* GL_NVX_gpu_multicast2 */
+
 #ifndef GL_NVX_linked_gpu_multicast
 #define GL_NVX_linked_gpu_multicast 1
 #define GL_LGPU_SEPARATE_STORAGE_BIT_NVX  0x0800
@@ -9333,6 +9452,20 @@ GLAPI void APIENTRY glLGPUInterlockNVX (void);
 #endif
 #endif /* GL_NVX_linked_gpu_multicast */
 
+#ifndef GL_NVX_progress_fence
+#define GL_NVX_progress_fence 1
+typedef GLuint (APIENTRYP PFNGLCREATEPROGRESSFENCENVXPROC) (void);
+typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREUI64NVXPROC) (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+typedef void (APIENTRYP PFNGLWAITSEMAPHOREUI64NVXPROC) (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+typedef void (APIENTRYP PFNGLCLIENTWAITSEMAPHOREUI64NVXPROC) (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLuint APIENTRY glCreateProgressFenceNVX (void);
+GLAPI void APIENTRY glSignalSemaphoreui64NVX (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+GLAPI void APIENTRY glWaitSemaphoreui64NVX (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+GLAPI void APIENTRY glClientWaitSemaphoreui64NVX (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
+#endif
+#endif /* GL_NVX_progress_fence */
+
 #ifndef GL_NV_alpha_to_coverage_dither_control
 #define GL_NV_alpha_to_coverage_dither_control 1
 #define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D
@@ -9545,6 +9678,10 @@ GLAPI void APIENTRY glCallCommandListNV (GLuint list);
 #define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC
 #endif /* GL_NV_compute_program5 */
 
+#ifndef GL_NV_compute_shader_derivatives
+#define GL_NV_compute_shader_derivatives 1
+#endif /* GL_NV_compute_shader_derivatives */
+
 #ifndef GL_NV_conditional_render
 #define GL_NV_conditional_render 1
 #define GL_QUERY_WAIT_NV                  0x8E13
@@ -9843,6 +9980,10 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
 #define GL_NV_fragment_program_option 1
 #endif /* GL_NV_fragment_program_option */
 
+#ifndef GL_NV_fragment_shader_barycentric
+#define GL_NV_fragment_shader_barycentric 1
+#endif /* GL_NV_fragment_shader_barycentric */
+
 #ifndef GL_NV_fragment_shader_interlock
 #define GL_NV_fragment_shader_interlock 1
 #endif /* GL_NV_fragment_shader_interlock */
@@ -9858,11 +9999,11 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
 #define GL_COVERAGE_MODULATION_NV         0x9332
 #define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333
 typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v);
-typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v);
+typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v);
 typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components);
 #ifdef GL_GLEXT_PROTOTYPES
 GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v);
-GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v);
+GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v);
 GLAPI void APIENTRY glCoverageModulationNV (GLenum components);
 #endif
 #endif /* GL_NV_framebuffer_mixed_samples */
@@ -10115,9 +10256,9 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN
 #define GL_SUPERSAMPLE_SCALE_X_NV         0x9372
 #define GL_SUPERSAMPLE_SCALE_Y_NV         0x9373
 #define GL_CONFORMANT_NV                  0x9374
-typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
+typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
 #ifdef GL_GLEXT_PROTOTYPES
-GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
+GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
 #endif
 #endif /* GL_NV_internalformat_sample_query */
 
@@ -10127,6 +10268,96 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna
 #define GL_MAX_SPOT_EXPONENT_NV           0x8505
 #endif /* GL_NV_light_max_exponent */
 
+#ifndef GL_NV_memory_attachment
+#define GL_NV_memory_attachment 1
+#define GL_ATTACHED_MEMORY_OBJECT_NV      0x95A4
+#define GL_ATTACHED_MEMORY_OFFSET_NV      0x95A5
+#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6
+#define GL_MEMORY_ATTACHABLE_SIZE_NV      0x95A7
+#define GL_MEMORY_ATTACHABLE_NV           0x95A8
+#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9
+#define GL_DETACHED_TEXTURES_NV           0x95AA
+#define GL_DETACHED_BUFFERS_NV            0x95AB
+#define GL_MAX_DETACHED_TEXTURES_NV       0x95AC
+#define GL_MAX_DETACHED_BUFFERS_NV        0x95AD
+typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
+typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname);
+typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
+typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
+typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset);
+typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
+GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname);
+GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
+GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
+GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset);
+GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset);
+#endif
+#endif /* GL_NV_memory_attachment */
+
+#ifndef GL_NV_mesh_shader
+#define GL_NV_mesh_shader 1
+#define GL_MESH_SHADER_NV                 0x9559
+#define GL_TASK_SHADER_NV                 0x955A
+#define GL_MAX_MESH_UNIFORM_BLOCKS_NV     0x8E60
+#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61
+#define GL_MAX_MESH_IMAGE_UNIFORMS_NV     0x8E62
+#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63
+#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64
+#define GL_MAX_MESH_ATOMIC_COUNTERS_NV    0x8E65
+#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66
+#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67
+#define GL_MAX_TASK_UNIFORM_BLOCKS_NV     0x8E68
+#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69
+#define GL_MAX_TASK_IMAGE_UNIFORMS_NV     0x8E6A
+#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B
+#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C
+#define GL_MAX_TASK_ATOMIC_COUNTERS_NV    0x8E6D
+#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E
+#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F
+#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2
+#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3
+#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV  0x9536
+#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV  0x9537
+#define GL_MAX_MESH_OUTPUT_VERTICES_NV    0x9538
+#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV  0x9539
+#define GL_MAX_TASK_OUTPUT_COUNT_NV       0x953A
+#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV   0x953D
+#define GL_MAX_MESH_VIEWS_NV              0x9557
+#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF
+#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543
+#define GL_MAX_MESH_WORK_GROUP_SIZE_NV    0x953B
+#define GL_MAX_TASK_WORK_GROUP_SIZE_NV    0x953C
+#define GL_MESH_WORK_GROUP_SIZE_NV        0x953E
+#define GL_TASK_WORK_GROUP_SIZE_NV        0x953F
+#define GL_MESH_VERTICES_OUT_NV           0x9579
+#define GL_MESH_PRIMITIVES_OUT_NV         0x957A
+#define GL_MESH_OUTPUT_TYPE_NV            0x957B
+#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C
+#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D
+#define GL_REFERENCED_BY_MESH_SHADER_NV   0x95A0
+#define GL_REFERENCED_BY_TASK_SHADER_NV   0x95A1
+#define GL_MESH_SHADER_BIT_NV             0x00000040
+#define GL_TASK_SHADER_BIT_NV             0x00000080
+#define GL_MESH_SUBROUTINE_NV             0x957C
+#define GL_TASK_SUBROUTINE_NV             0x957D
+#define GL_MESH_SUBROUTINE_UNIFORM_NV     0x957E
+#define GL_TASK_SUBROUTINE_UNIFORM_NV     0x957F
+#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E
+#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F
+typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count);
+typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect);
+typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride);
+typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count);
+GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect);
+GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride);
+GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
+#endif
+#endif /* GL_NV_mesh_shader */
+
 #ifndef GL_NV_multisample_coverage
 #define GL_NV_multisample_coverage 1
 #endif /* GL_NV_multisample_coverage */
@@ -10408,7 +10639,7 @@ typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, co
 typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
 typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
 typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
-typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
+typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
 typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
 typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
 typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode);
@@ -10473,7 +10704,7 @@ GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fo
 GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
 GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
 GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
-GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
+GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
 GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
 GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
 GLAPI void APIENTRY glPathFogGenNV (GLenum genMode);
@@ -10562,9 +10793,9 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index);
 #define GL_QUERY_RESOURCE_TEXTURE_NV      0x9545
 #define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546
 #define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547
-typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer);
+typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
 #ifdef GL_GLEXT_PROTOTYPES
-GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer);
+GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
 #endif
 #endif /* GL_NV_query_resource */
 
@@ -10672,6 +10903,11 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname,
 #endif
 #endif /* GL_NV_register_combiners2 */
 
+#ifndef GL_NV_representative_fragment_test
+#define GL_NV_representative_fragment_test 1
+#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F
+#endif /* GL_NV_representative_fragment_test */
+
 #ifndef GL_NV_robustness_video_memory_purge
 #define GL_NV_robustness_video_memory_purge 1
 #define GL_PURGED_CONTEXT_RESET_NV        0x92BB
@@ -10701,6 +10937,18 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void);
 #define GL_NV_sample_mask_override_coverage 1
 #endif /* GL_NV_sample_mask_override_coverage */
 
+#ifndef GL_NV_scissor_exclusive
+#define GL_NV_scissor_exclusive 1
+#define GL_SCISSOR_TEST_EXCLUSIVE_NV      0x9555
+#define GL_SCISSOR_BOX_EXCLUSIVE_NV       0x9556
+typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height);
+typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height);
+GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v);
+#endif
+#endif /* GL_NV_scissor_exclusive */
+
 #ifndef GL_NV_shader_atomic_counters
 #define GL_NV_shader_atomic_counters 1
 #endif /* GL_NV_shader_atomic_counters */
@@ -10765,6 +11013,15 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
 #define GL_NV_shader_storage_buffer_object 1
 #endif /* GL_NV_shader_storage_buffer_object */
 
+#ifndef GL_NV_shader_subgroup_partitioned
+#define GL_NV_shader_subgroup_partitioned 1
+#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100
+#endif /* GL_NV_shader_subgroup_partitioned */
+
+#ifndef GL_NV_shader_texture_footprint
+#define GL_NV_shader_texture_footprint 1
+#endif /* GL_NV_shader_texture_footprint */
+
 #ifndef GL_NV_shader_thread_group
 #define GL_NV_shader_thread_group 1
 #define GL_WARP_SIZE_NV                   0x9339
@@ -10776,6 +11033,47 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
 #define GL_NV_shader_thread_shuffle 1
 #endif /* GL_NV_shader_thread_shuffle */
 
+#ifndef GL_NV_shading_rate_image
+#define GL_NV_shading_rate_image 1
+#define GL_SHADING_RATE_IMAGE_NV          0x9563
+#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564
+#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565
+#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566
+#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567
+#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568
+#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569
+#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A
+#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B
+#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C
+#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D
+#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E
+#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F
+#define GL_SHADING_RATE_IMAGE_BINDING_NV  0x955B
+#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C
+#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D
+#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E
+#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F
+#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE
+#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF
+#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0
+typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture);
+typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate);
+typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location);
+typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize);
+typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
+typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order);
+typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture);
+GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate);
+GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location);
+GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize);
+GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
+GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order);
+GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations);
+#endif
+#endif /* GL_NV_shading_rate_image */
+
 #ifndef GL_NV_stereo_view_rendering
 #define GL_NV_stereo_view_rendering 1
 #endif /* GL_NV_stereo_view_rendering */
@@ -11068,7 +11366,7 @@ typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const
 typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
 typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface);
 typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface);
-typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
+typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
 typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access);
 typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
 typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
@@ -11079,13 +11377,21 @@ GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSu
 GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
 GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface);
 GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface);
-GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
+GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
 GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access);
 GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
 GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
 #endif
 #endif /* GL_NV_vdpau_interop */
 
+#ifndef GL_NV_vdpau_interop2
+#define GL_NV_vdpau_interop2 1
+typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
+#ifdef GL_GLEXT_PROTOTYPES
+GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
+#endif
+#endif /* GL_NV_vdpau_interop2 */
+
 #ifndef GL_NV_vertex_array_range
 #define GL_NV_vertex_array_range 1
 #define GL_VERTEX_ARRAY_RANGE_NV          0x851D

3rdparty/GL/khrplatform.h

@@ -0,0 +1,290 @@
+#ifndef __khrplatform_h_
+#define __khrplatform_h_
+
+/*
+** Copyright (c) 2008-2018 The Khronos Group Inc.
+**
+** Permission is hereby granted, free of charge, to any person obtaining a
+** copy of this software and/or associated documentation files (the
+** "Materials"), to deal in the Materials without restriction, including
+** without limitation the rights to use, copy, modify, merge, publish,
+** distribute, sublicense, and/or sell copies of the Materials, and to
+** permit persons to whom the Materials are furnished to do so, subject to
+** the following conditions:
+**
+** The above copyright notice and this permission notice shall be included
+** in all copies or substantial portions of the Materials.
+**
+** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
+** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
+** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
+** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY
+** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
+** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
+** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
+*/
+
+/* Khronos platform-specific types and definitions.
+ *
+ * The master copy of khrplatform.h is maintained in the Khronos EGL
+ * Registry repository at https://github.com/KhronosGroup/EGL-Registry
+ * The last semantic modification to khrplatform.h was at commit ID:
+ *      67a3e0864c2d75ea5287b9f3d2eb74a745936692
+ *
+ * Adopters may modify this file to suit their platform. Adopters are
+ * encouraged to submit platform specific modifications to the Khronos
+ * group so that they can be included in future versions of this file.
+ * Please submit changes by filing pull requests or issues on
+ * the EGL Registry repository linked above.
+ *
+ *
+ * See the Implementer's Guidelines for information about where this file
+ * should be located on your system and for more details of its use:
+ *    http://www.khronos.org/registry/implementers_guide.pdf
+ *
+ * This file should be included as
+ *        #include <KHR/khrplatform.h>
+ * by Khronos client API header files that use its types and defines.
+ *
+ * The types in khrplatform.h should only be used to define API-specific types.
+ *
+ * Types defined in khrplatform.h:
+ *    khronos_int8_t              signed   8  bit
+ *    khronos_uint8_t             unsigned 8  bit
+ *    khronos_int16_t             signed   16 bit
+ *    khronos_uint16_t            unsigned 16 bit
+ *    khronos_int32_t             signed   32 bit
+ *    khronos_uint32_t            unsigned 32 bit
+ *    khronos_int64_t             signed   64 bit
+ *    khronos_uint64_t            unsigned 64 bit
+ *    khronos_intptr_t            signed   same number of bits as a pointer
+ *    khronos_uintptr_t           unsigned same number of bits as a pointer
+ *    khronos_ssize_t             signed   size
+ *    khronos_usize_t             unsigned size
+ *    khronos_float_t             signed   32 bit floating point
+ *    khronos_time_ns_t           unsigned 64 bit time in nanoseconds
+ *    khronos_utime_nanoseconds_t unsigned time interval or absolute time in
+ *                                         nanoseconds
+ *    khronos_stime_nanoseconds_t signed time interval in nanoseconds
+ *    khronos_boolean_enum_t      enumerated boolean type. This should
+ *      only be used as a base type when a client API's boolean type is
+ *      an enum. Client APIs which use an integer or other type for
+ *      booleans cannot use this as the base type for their boolean.
+ *
+ * Tokens defined in khrplatform.h:
+ *
+ *    KHRONOS_FALSE, KHRONOS_TRUE Enumerated boolean false/true values.
+ *
+ *    KHRONOS_SUPPORT_INT64 is 1 if 64 bit integers are supported; otherwise 0.
+ *    KHRONOS_SUPPORT_FLOAT is 1 if floats are supported; otherwise 0.
+ *
+ * Calling convention macros defined in this file:
+ *    KHRONOS_APICALL
+ *    KHRONOS_APIENTRY
+ *    KHRONOS_APIATTRIBUTES
+ *
+ * These may be used in function prototypes as:
+ *
+ *      KHRONOS_APICALL void KHRONOS_APIENTRY funcname(
+ *                                  int arg1,
+ *                                  int arg2) KHRONOS_APIATTRIBUTES;
+ */
+
+#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC)
+#   define KHRONOS_STATIC 1
+#endif
+
+/*-------------------------------------------------------------------------
+ * Definition of KHRONOS_APICALL
+ *-------------------------------------------------------------------------
+ * This precedes the return type of the function in the function prototype.
+ */
+#if defined(KHRONOS_STATIC)
+    /* If the preprocessor constant KHRONOS_STATIC is defined, make the
+     * header compatible with static linking. */
+#   define KHRONOS_APICALL
+#elif defined(_WIN32)
+#   define KHRONOS_APICALL __declspec(dllimport)
+#elif defined (__SYMBIAN32__)
+#   define KHRONOS_APICALL IMPORT_C
+#elif defined(__ANDROID__)
+#   define KHRONOS_APICALL __attribute__((visibility("default")))
+#else
+#   define KHRONOS_APICALL
+#endif
+
+/*-------------------------------------------------------------------------
+ * Definition of KHRONOS_APIENTRY
+ *-------------------------------------------------------------------------
+ * This follows the return type of the function  and precedes the function
+ * name in the function prototype.
+ */
+#if defined(_WIN32) && !defined(_WIN32_WCE) && !defined(KHRONOS_STATIC)
+    /* Win32 but not WinCE */
+#   define KHRONOS_APIENTRY __stdcall
+#else
+#   define KHRONOS_APIENTRY
+#endif
+
+/*-------------------------------------------------------------------------
+ * Definition of KHRONOS_APIATTRIBUTES
+ *-------------------------------------------------------------------------
+ * This follows the closing parenthesis of the function prototype arguments.
+ */
+#if defined (__ARMCC_2__)
+#define KHRONOS_APIATTRIBUTES __softfp
+#else
+#define KHRONOS_APIATTRIBUTES
+#endif
+
+/*-------------------------------------------------------------------------
+ * basic type definitions
+ *-----------------------------------------------------------------------*/
+#if (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || defined(__GNUC__) || defined(__SCO__) || defined(__USLC__)
+
+
+/*
+ * Using <stdint.h>
+ */
+#include <stdint.h>
+typedef int32_t                 khronos_int32_t;
+typedef uint32_t                khronos_uint32_t;
+typedef int64_t                 khronos_int64_t;
+typedef uint64_t                khronos_uint64_t;
+#define KHRONOS_SUPPORT_INT64   1
+#define KHRONOS_SUPPORT_FLOAT   1
+
+#elif defined(__VMS ) || defined(__sgi)
+
+/*
+ * Using <inttypes.h>
+ */
+#include <inttypes.h>
+typedef int32_t                 khronos_int32_t;
+typedef uint32_t                khronos_uint32_t;
+typedef int64_t                 khronos_int64_t;
+typedef uint64_t                khronos_uint64_t;
+#define KHRONOS_SUPPORT_INT64   1
+#define KHRONOS_SUPPORT_FLOAT   1
+
+#elif defined(_WIN32) && !defined(__SCITECH_SNAP__)
+
+/*
+ * Win32
+ */
+typedef __int32                 khronos_int32_t;
+typedef unsigned __int32        khronos_uint32_t;
+typedef __int64                 khronos_int64_t;
+typedef unsigned __int64        khronos_uint64_t;
+#define KHRONOS_SUPPORT_INT64   1
+#define KHRONOS_SUPPORT_FLOAT   1
+
+#elif defined(__sun__) || defined(__digital__)
+
+/*
+ * Sun or Digital
+ */
+typedef int                     khronos_int32_t;
+typedef unsigned int            khronos_uint32_t;
+#if defined(__arch64__) || defined(_LP64)
+typedef long int                khronos_int64_t;
+typedef unsigned long int       khronos_uint64_t;
+#else
+typedef long long int           khronos_int64_t;
+typedef unsigned long long int  khronos_uint64_t;
+#endif /* __arch64__ */
+#define KHRONOS_SUPPORT_INT64   1
+#define KHRONOS_SUPPORT_FLOAT   1
+
+#elif 0
+
+/*
+ * Hypothetical platform with no float or int64 support
+ */
+typedef int                     khronos_int32_t;
+typedef unsigned int            khronos_uint32_t;
+#define KHRONOS_SUPPORT_INT64   0
+#define KHRONOS_SUPPORT_FLOAT   0
+
+#else
+
+/*
+ * Generic fallback
+ */
+#include <stdint.h>
+typedef int32_t                 khronos_int32_t;
+typedef uint32_t                khronos_uint32_t;
+typedef int64_t                 khronos_int64_t;
+typedef uint64_t                khronos_uint64_t;
+#define KHRONOS_SUPPORT_INT64   1
+#define KHRONOS_SUPPORT_FLOAT   1
+
+#endif
+
+
+/*
+ * Types that are (so far) the same on all platforms
+ */
+typedef signed   char          khronos_int8_t;
+typedef unsigned char          khronos_uint8_t;
+typedef signed   short int     khronos_int16_t;
+typedef unsigned short int     khronos_uint16_t;
+
+/*
+ * Types that differ between LLP64 and LP64 architectures - in LLP64,
+ * pointers are 64 bits, but 'long' is still 32 bits. Win64 appears
+ * to be the only LLP64 architecture in current use.
+ */
+#ifdef _WIN64
+typedef signed   long long int khronos_intptr_t;
+typedef unsigned long long int khronos_uintptr_t;
+typedef signed   long long int khronos_ssize_t;
+typedef unsigned long long int khronos_usize_t;
+#else
+typedef signed   long  int     khronos_intptr_t;
+typedef unsigned long  int     khronos_uintptr_t;
+typedef signed   long  int     khronos_ssize_t;
+typedef unsigned long  int     khronos_usize_t;
+#endif
+
+#if KHRONOS_SUPPORT_FLOAT
+/*
+ * Float type
+ */
+typedef          float         khronos_float_t;
+#endif
+
+#if KHRONOS_SUPPORT_INT64
+/* Time types
+ *
+ * These types can be used to represent a time interval in nanoseconds or
+ * an absolute Unadjusted System Time.  Unadjusted System Time is the number
+ * of nanoseconds since some arbitrary system event (e.g. since the last
+ * time the system booted).  The Unadjusted System Time is an unsigned
+ * 64 bit value that wraps back to 0 every 584 years.  Time intervals
+ * may be either signed or unsigned.
+ */
+typedef khronos_uint64_t       khronos_utime_nanoseconds_t;
+typedef khronos_int64_t        khronos_stime_nanoseconds_t;
+#endif
+
+/*
+ * Dummy value used to pad enum types to 32 bits.
+ */
+#ifndef KHRONOS_MAX_ENUM
+#define KHRONOS_MAX_ENUM 0x7FFFFFFF
+#endif
+
+/*
+ * Enumerated boolean type
+ *
+ * Values other than zero should be considered to be true.  Therefore
+ * comparisons should not be made against KHRONOS_TRUE.
+ */
+typedef enum {
+    KHRONOS_FALSE = 0,
+    KHRONOS_TRUE  = 1,
+    KHRONOS_BOOLEAN_ENUM_FORCE_SIZE = KHRONOS_MAX_ENUM
+} khronos_boolean_enum_t;
+
+#endif /* __khrplatform_h_ */

3rdparty/curl_extra/wolfssl/options.h

@@ -0,0 +1,40 @@
+/* options.h.in
+ *
+ * Copyright (C) 2006-2020 wolfSSL Inc.
+ *
+ * This file is part of wolfSSL.
+ *
+ * wolfSSL is free software; you can redistribute it and/or modify
+ * it under the terms of the GNU General Public License as published by
+ * the Free Software Foundation; either version 2 of the License, or
+ * (at your option) any later version.
+ *
+ * wolfSSL is distributed in the hope that it will be useful,
+ * but WITHOUT ANY WARRANTY; without even the implied warranty of
+ * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
+ * GNU General Public License for more details.
+ *
+ * You should have received a copy of the GNU General Public License
+ * along with this program; if not, write to the Free Software
+ * Foundation, Inc., 51 Franklin Street, Fifth Floor, Boston, MA 02110-1335, USA
+ */
+
+
+/* default blank options for autoconf */
+
+#ifndef WOLFSSL_OPTIONS_H
+#define WOLFSSL_OPTIONS_H
+
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+
+#ifdef __cplusplus
+}
+#endif
+
+
+#endif /* WOLFSSL_OPTIONS_H */
+

3rdparty/hidapi.vcxproj

@@ -27,6 +27,9 @@
     <CharacterSet>MultiByte</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">

3rdparty/libcurl.vcxproj

@@ -31,6 +31,9 @@
     <CharacterSet>Unicode</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="PropertySheets">
@@ -48,8 +51,8 @@
     <ClCompile>
       <Optimization>MaxSpeed</Optimization>
       <InlineFunctionExpansion>OnlyExplicitInline</InlineFunctionExpansion>
-      <AdditionalIncludeDirectories>curl\include;curl\lib;wolfssl;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
-      <PreprocessorDefinitions>HAVE_SNI;NDEBUG;BUILDING_LIBCURL;CURL_STATICLIB;USE_WOLFSSL;USE_IPV6;%(PreprocessorDefinitions)</PreprocessorDefinitions>
+      <AdditionalIncludeDirectories>curl\include;curl\lib;curl_extra;wolfssl;wolfssl\wolfssl;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
+      <PreprocessorDefinitions>HAVE_SNI;NDEBUG;BUILDING_LIBCURL;CURL_STATICLIB;USE_WOLFSSL;USE_IPV6;SIZEOF_LONG=4;SIZEOF_LONG_LONG=8;%(PreprocessorDefinitions)</PreprocessorDefinitions>
       <StringPooling>true</StringPooling>
       <FunctionLevelLinking>true</FunctionLevelLinking>
       <WarningLevel>Level4</WarningLevel>
@@ -94,6 +97,7 @@
     <ClCompile Include="curl\lib\dict.c" />
     <ClCompile Include="curl\lib\doh.c" />
     <ClCompile Include="curl\lib\dotdot.c" />
+    <ClCompile Include="curl\lib\dynbuf.c" />
     <ClCompile Include="curl\lib\easy.c" />
     <ClCompile Include="curl\lib\escape.c" />
     <ClCompile Include="curl\lib\file.c" />
@@ -132,6 +136,7 @@
     <ClCompile Include="curl\lib\memdebug.c" />
     <ClCompile Include="curl\lib\mime.c" />
     <ClCompile Include="curl\lib\mprintf.c" />
+    <ClCompile Include="curl\lib\mqtt.c" />
     <ClCompile Include="curl\lib\multi.c" />
     <ClCompile Include="curl\lib\netrc.c" />
     <ClCompile Include="curl\lib\non-ascii.c" />
@@ -175,6 +180,7 @@
     <ClCompile Include="curl\lib\url.c" />
     <ClCompile Include="curl\lib\urlapi.c" />
     <ClCompile Include="curl\lib\version.c" />
+    <ClCompile Include="curl\lib\version_win32.c" />
     <ClCompile Include="curl\lib\warnless.c" />
     <ClCompile Include="curl\lib\wildcard.c" />
     <ClCompile Include="curl\lib\x509asn1.c" />
@@ -192,12 +198,14 @@
     <ClCompile Include="curl\lib\vauth\vauth.c" />
     <ClCompile Include="curl\lib\vquic\ngtcp2.c" />
     <ClCompile Include="curl\lib\vquic\quiche.c" />
+    <ClCompile Include="curl\lib\vquic\vquic.c" />
     <ClCompile Include="curl\lib\vssh\libssh.c" />
     <ClCompile Include="curl\lib\vssh\libssh2.c" />
     <ClCompile Include="curl\lib\vssh\wolfssh.c" />
     <ClCompile Include="curl\lib\vtls\bearssl.c" />
     <ClCompile Include="curl\lib\vtls\gskit.c" />
     <ClCompile Include="curl\lib\vtls\gtls.c" />
+    <ClCompile Include="curl\lib\vtls\keylog.c" />
     <ClCompile Include="curl\lib\vtls\mbedtls.c" />
     <ClCompile Include="curl\lib\vtls\mbedtls_threadlock.c" />
     <ClCompile Include="curl\lib\vtls\mesalink.c" />
@@ -271,6 +279,7 @@
     <ClInclude Include="curl\lib\dict.h" />
     <ClInclude Include="curl\lib\doh.h" />
     <ClInclude Include="curl\lib\dotdot.h" />
+    <ClInclude Include="curl\lib\dynbuf.h" />
     <ClInclude Include="curl\lib\easyif.h" />
     <ClInclude Include="curl\lib\escape.h" />
     <ClInclude Include="curl\lib\file.h" />
@@ -297,6 +306,7 @@
     <ClInclude Include="curl\lib\llist.h" />
     <ClInclude Include="curl\lib\memdebug.h" />
     <ClInclude Include="curl\lib\mime.h" />
+    <ClInclude Include="curl\lib\mqtt.h" />
     <ClInclude Include="curl\lib\multihandle.h" />
     <ClInclude Include="curl\lib\multiif.h" />
     <ClInclude Include="curl\lib\netrc.h" />
@@ -316,6 +326,7 @@
     <ClInclude Include="curl\lib\setopt.h" />
     <ClInclude Include="curl\lib\setup-os400.h" />
     <ClInclude Include="curl\lib\setup-vms.h" />
+    <ClInclude Include="curl\lib\setup-win32.h" />
     <ClInclude Include="curl\lib\share.h" />
     <ClInclude Include="curl\lib\sigpipe.h" />
     <ClInclude Include="curl\lib\slist.h" />
@@ -339,6 +350,7 @@
     <ClInclude Include="curl\lib\url.h" />
     <ClInclude Include="curl\lib\urlapi-int.h" />
     <ClInclude Include="curl\lib\urldata.h" />
+    <ClInclude Include="curl\lib\version_win32.h" />
     <ClInclude Include="curl\lib\warnless.h" />
     <ClInclude Include="curl\lib\wildcard.h" />
     <ClInclude Include="curl\lib\x509asn1.h" />
@@ -347,11 +359,13 @@
     <ClInclude Include="curl\lib\vauth\vauth.h" />
     <ClInclude Include="curl\lib\vquic\ngtcp2.h" />
     <ClInclude Include="curl\lib\vquic\quiche.h" />
+    <ClInclude Include="curl\lib\vquic\vquic.h" />
     <ClInclude Include="curl\lib\vssh\ssh.h" />
     <ClInclude Include="curl\lib\vssh\wolfssh.h" />
     <ClInclude Include="curl\lib\vtls\bearssl.h" />
     <ClInclude Include="curl\lib\vtls\gskit.h" />
     <ClInclude Include="curl\lib\vtls\gtls.h" />
+    <ClInclude Include="curl\lib\vtls\keylog.h" />
     <ClInclude Include="curl\lib\vtls\mbedtls.h" />
     <ClInclude Include="curl\lib\vtls\mbedtls_threadlock.h" />
     <ClInclude Include="curl\lib\vtls\mesalink.h" />

3rdparty/libpng.vcxproj

@@ -28,6 +28,9 @@
     <CharacterSet>MultiByte</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug Library|x64'" Label="PropertySheets">
@@ -97,7 +100,7 @@
       <DisableSpecificWarnings>$(DisableSpecificWarnings)</DisableSpecificWarnings>
       <AdditionalIncludeDirectories>$(ZLibSrcDir);%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
       <TreatWarningAsError>$(TreatWarningAsError)</TreatWarningAsError>
-      <Optimization>Full</Optimization>
+      <Optimization>MaxSpeed</Optimization>
       <WholeProgramOptimization>true</WholeProgramOptimization>
     </ClCompile>
     <Link>

3rdparty/libusb_cmake/os.cmake

@@ -6,6 +6,7 @@ if (CMAKE_USE_PTHREADS_INIT)
 endif()
 
 if (WIN32 OR "${CMAKE_SYSTEM_NAME}" STREQUAL "CYGWIN")
+	add_compile_definitions(PLATFORM_WINDOWS=1)
 	set(OS_WINDOWS 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
 
 	# Enable MingW support for RC language (for CMake pre-2.8)
@@ -22,9 +23,9 @@ if (WIN32 OR "${CMAKE_SYSTEM_NAME}" STREQUAL "CYGWIN")
 	endif()
 
 	list(APPEND PLATFORM_SRC
-		poll_windows.c
+		events_windows.c
 		windows_usbdk.c
-		windows_nt_common.c
+		windows_common.c
 		windows_winusb.c
 		threads_windows.c
 	)
@@ -36,13 +37,14 @@ if (WIN32 OR "${CMAKE_SYSTEM_NAME}" STREQUAL "CYGWIN")
 	endif()
 elseif (APPLE)
 	# Apple != OSX alone
+	add_compile_definitions(PLATFORM_POSIX=1 HAVE_CLOCK_GETTIME)
 	set(OS_DARWIN 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
 
 	if ("${CMAKE_SYSTEM_NAME}" STREQUAL "Darwin")
 		set(PLATFORM_SRC
 			darwin_usb.c
 			threads_posix.c
-			poll_posix.c
+			events_posix.c
 		)
 
 		find_package(IOKit REQUIRED)
@@ -72,6 +74,7 @@ int main()
 	endif()
 elseif (UNIX)
 	# Unix is for all *NIX systems including OSX
+	add_compile_definitions(PLATFORM_POSIX=1 HAVE_CLOCK_GETTIME)
 	if ("${CMAKE_SYSTEM_NAME}" STREQUAL "Linux")
 		set(OS_LINUX 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
 
@@ -79,7 +82,7 @@ elseif (UNIX)
 			linux_usbfs.c
 			linux_netlink.c
 			threads_posix.c
-			poll_posix.c
+			events_posix.c
 		)
 
 		list(APPEND LIBUSB_LIBRARIES rt)

3rdparty/libusb_static.vcxproj

@@ -24,6 +24,9 @@
     <WholeProgramOptimization Condition="'$(Configuration)'=='Release'">true</WholeProgramOptimization>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="PropertySheets">
@@ -38,8 +41,9 @@
   </PropertyGroup>
   <ItemDefinitionGroup>
     <ClCompile>
+      <AdditionalOptions>/utf-8 %(AdditionalOptions)</AdditionalOptions>
       <AdditionalIncludeDirectories>libusb\msvc;libusb\libusb;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
-      <PreprocessorDefinitions>WINVER=0x0501;_WIN32_WINNT=0x0501;_LIB;_CRT_SECURE_NO_WARNINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
+      <PreprocessorDefinitions>WINVER=0x0600;_WIN32_WINNT=0x0600;_LIB;_CRT_SECURE_NO_WARNINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
       <ProgramDataBaseFileName>$(IntDir)$(TargetName).pdb</ProgramDataBaseFileName>
       <WarningLevel>Level4</WarningLevel>
     </ClCompile>
@@ -61,11 +65,11 @@
     <ClCompile Include="libusb\libusb\descriptor.c" />
     <ClCompile Include="libusb\libusb\hotplug.c" />
     <ClCompile Include="libusb\libusb\io.c" />
-    <ClCompile Include="libusb\libusb\os\poll_windows.c" />
+    <ClCompile Include="libusb\libusb\os\events_windows.c" />
     <ClCompile Include="libusb\libusb\strerror.c" />
     <ClCompile Include="libusb\libusb\sync.c" />
     <ClCompile Include="libusb\libusb\os\threads_windows.c" />
-    <ClCompile Include="libusb\libusb\os\windows_nt_common.c" />
+    <ClCompile Include="libusb\libusb\os\windows_common.c" />
     <ClCompile Include="libusb\libusb\os\windows_usbdk.c" />
     <ClCompile Include="libusb\libusb\os\windows_winusb.c" />
   </ItemGroup>
@@ -74,13 +78,11 @@
     <ClInclude Include="libusb\libusb\hotplug.h" />
     <ClInclude Include="libusb\libusb\libusb.h" />
     <ClInclude Include="libusb\libusb\libusbi.h" />
-    <ClInclude Include="libusb\libusb\os\poll_windows.h" />
+    <ClInclude Include="libusb\libusb\os\events_windows.h" />
     <ClInclude Include="libusb\libusb\os\threads_windows.h" />
     <ClInclude Include="libusb\libusb\version.h" />
     <ClInclude Include="libusb\libusb\version_nano.h" />
     <ClInclude Include="libusb\libusb\os\windows_common.h" />
-    <ClInclude Include="libusb\libusb\os\windows_nt_common.h" />
-    <ClInclude Include="libusb\libusb\os\windows_nt_shared_types.h" />
     <ClInclude Include="libusb\libusb\os\windows_usbdk.h" />
     <ClInclude Include="libusb\libusb\os\windows_winusb.h" />
   </ItemGroup>

3rdparty/llvm.cmake

@@ -11,7 +11,6 @@ if(WITH_LLVM)
 		option(LLVM_INCLUDE_TESTS OFF)
 		option(LLVM_INCLUDE_TOOLS OFF)
 		option(LLVM_INCLUDE_UTILS OFF)
-		option(WITH_POLLY OFF)
 		option(LLVM_CCACHE_BUILD ON)
 
 		set(CXX_FLAGS_OLD ${CMAKE_CXX_FLAGS})

3rdparty/pnglibconf.vcxproj

@@ -21,6 +21,9 @@
   </PropertyGroup>
   <Import Project="$(SolutionDir)\3rdparty\zlib.props" />
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'">

3rdparty/qt5.cmake

@@ -1,11 +1,13 @@
 add_library(3rdparty_qt5 INTERFACE)
 
-find_package(Qt5 5.14 CONFIG COMPONENTS Widgets Concurrent)
+set(QT_MIN_VER 5.15.2)
+
+find_package(Qt5 ${QT_MIN_VER} CONFIG COMPONENTS Widgets Concurrent)
 if(WIN32)
-	find_package(Qt5 5.14 COMPONENTS WinExtras REQUIRED)
+	find_package(Qt5 ${QT_MIN_VER} COMPONENTS WinExtras REQUIRED)
 	target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::WinExtras Qt5::Concurrent)
 else()
-	find_package(Qt5 5.14 COMPONENTS DBus Gui)
+	find_package(Qt5 ${QT_MIN_VER} COMPONENTS DBus Gui)
 	if(Qt5DBus_FOUND)
 		target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::DBus Qt5::Concurrent)
 		target_compile_definitions(3rdparty_qt5 INTERFACE -DHAVE_QTDBUS)
@@ -16,16 +18,12 @@ else()
 endif()
 
 if(NOT Qt5Widgets_FOUND)
-	if(Qt5Widgets_VERSION VERSION_LESS 5.14.0)
-		message("Minimum supported Qt5 version is 5.14.0! You have version ${Qt5Widgets_VERSION} installed, please upgrade!")
+	if(Qt5Widgets_VERSION VERSION_LESS ${QT_MIN_VER})
+		message("Minimum supported Qt5 version is ${QT_MIN_VER}! You have version ${Qt5Widgets_VERSION} installed, please upgrade!")
 		if(CMAKE_SYSTEM MATCHES "Linux")
 			message(FATAL_ERROR "Most distros do not provide an up-to-date version of Qt.
 If you're on Ubuntu or Linux Mint, there are PPAs you can use to install one of the latest qt5 versions.
-		https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.14.1-bionic
-		https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.14.1-xenial
-just make sure to run
-	source /opt/qt514/bin/qt514-env.sh
-before re-running cmake")
+Find the correct ppa at https://launchpad.net/~beineri and follow the instructions.")
 		elseif(WIN32)
 			message(FATAL_ERROR "You can download the latest version of Qt5 here: https://www.qt.io/download-open-source/")
 		else()
@@ -35,7 +33,7 @@ before re-running cmake")
 
 	message("CMake was unable to find Qt5!")
 	if(WIN32)
-		message(FATAL_ERROR "Make sure the QTDIR env variable has been set properly. (for example C:\\Qt\\5.14.1\\msvc2017_64\\)
+		message(FATAL_ERROR "Make sure the QTDIR env variable has been set properly. (for example C:\\Qt\\${QT_MIN_VER}\\msvc2019_64\\)
 You can also try setting the Qt5_DIR preprocessor definiton.")
 	elseif(CMAKE_SYSTEM MATCHES "Linux")
 		message(FATAL_ERROR "Make sure to install your distro's qt5 package!")

3rdparty/wolfssl.vcxproj

@@ -28,6 +28,9 @@
     <CharacterSet>Unicode</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">
@@ -45,7 +48,7 @@
     <ClCompile>
       <Optimization>Disabled</Optimization>
       <AdditionalIncludeDirectories>./wolfssl;./wolfssl/IDE/WIN;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
-      <PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
+      <PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_DES_ECB;HAVE_FFDHE_2048;TFM_TIMING_RESISTANT;ECC_TIMING_RESISTANT;WC_RSA_BLINDING;HAVE_AESGCM;WOLFSSL_SHA512;WOLFSSL_SHA384;NO_DSA;HAVE_ECC;TFM_ECC256;ECC_SHAMIR;NO_RC4;NO_HC128;NO_RABBIT;WOLFSSL_SHA224;WOLFSSL_SHA3;WOLFSSL_SHAKE256;HAVE_POLY1305;HAVE_ONE_TIME_AUTH;HAVE_CHACHA;HAVE_HASHDRBG;HAVE_TLS_EXTENSIONS;HAVE_SNI;HAVE_SUPPORTED_CURVES;HAVE_EXTENDED_MASTER;NO_RC4;HAVE_ENCRYPT_THEN_MAC;NO_PSK;NO_MD4;WC_NO_ASYNC_THREADING;OPENSSL_EXTRA;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
       <BasicRuntimeChecks>EnableFastChecks</BasicRuntimeChecks>
       <PrecompiledHeader>
       </PrecompiledHeader>
@@ -59,7 +62,7 @@
       <Optimization>MaxSpeed</Optimization>
       <IntrinsicFunctions>true</IntrinsicFunctions>
       <AdditionalIncludeDirectories>./wolfssl;./wolfssl/IDE/WIN;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
-      <PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
+      <PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_DES_ECB;HAVE_FFDHE_2048;TFM_TIMING_RESISTANT;NO_DSA;TFM_ECC256;NO_RC4;NO_HC128;NO_RABBIT;WOLFSSL_SHA224;WOLFSSL_SHA3;WOLFSSL_SHAKE256;HAVE_POLY1305;HAVE_ONE_TIME_AUTH;HAVE_CHACHA;HAVE_HASHDRBG;HAVE_SNI;HAVE_ENCRYPT_THEN_MAC;NO_MD4;WC_NO_ASYNC_THREADING;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;WC_NO_HARDEN;%(PreprocessorDefinitions)</PreprocessorDefinitions>
       <FunctionLevelLinking>true</FunctionLevelLinking>
       <PrecompiledHeader>
       </PrecompiledHeader>

3rdparty/xxhash.vcxproj

@@ -27,6 +27,9 @@
     <UseDebugLibraries>false</UseDebugLibraries>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="PropertySheets">
@@ -41,7 +44,10 @@
   </ImportGroup>
   <PropertyGroup Label="UserMacros" />
   <PropertyGroup />
-  <ItemDefinitionGroup>
+  <ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
+    <ClCompile>
+      <Optimization>MaxSpeed</Optimization>
+    </ClCompile>
   </ItemDefinitionGroup>
   <ItemGroup>
     <ClCompile Include="xxHash/xxhash.c" />

3rdparty/yaml-cpp.vcxproj

@@ -22,6 +22,9 @@
     <CharacterSet>Unicode</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="Shared">
@@ -40,6 +43,7 @@
   <ItemDefinitionGroup>
     <ClCompile>
       <ExceptionHandling>Sync</ExceptionHandling>
+      <Optimization Condition="'$(Configuration)|$(Platform)'=='Release|x64'">MaxSpeed</Optimization>
     </ClCompile>
   </ItemDefinitionGroup>
   <ItemGroup>

3rdparty/zlib.vcxproj

@@ -31,6 +31,9 @@
   <Import Project="$(SolutionDir)\3rdparty\zlib.props" />
   <Import Project="..\common_default.props" />
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <Import Project="..\common_default_macros.props" />
   <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
     <ConfigurationType>StaticLibrary</ConfigurationType>
@@ -79,7 +82,7 @@
     <ClCompile>
       <WarningLevel>$(WarningLevel)</WarningLevel>
       <DebugInformationFormat>ProgramDatabase</DebugInformationFormat>
-      <Optimization>Full</Optimization>
+      <Optimization>MaxSpeed</Optimization>
       <IntrinsicFunctions>true</IntrinsicFunctions>
       <WholeProgramOptimization>true</WholeProgramOptimization>
       <BufferSecurityCheck>false</BufferSecurityCheck>

BUILDING.md

@@ -9,19 +9,19 @@ Other instructions may be found [here](https://wiki.rpcs3.net/index.php?title=Bu
 
 * [CMake 3.14.1+](https://www.cmake.org/download/) (add to PATH)
 * [Python 3.3+](https://www.python.org/downloads/) (add to PATH)
-* [Qt 5.14+](https://www.qt.io/download-qt-installer)
+* [Qt 5.15.2](https://www.qt.io/download-qt-installer)
 * [Visual Studio 2019](https://visualstudio.microsoft.com/thank-you-downloading-visual-studio/?sku=Community)
 * [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/windows/getting_started.html))
 
-**Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.14.1\msvc2017_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools-19123)**
+**Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.15.2\msvc2019_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools2019)**
 
 ### Linux
 
 These are the essentials tools to build RPCS3 on Linux. Some of them can be installed through your favorite package manager.
 
-* Clang 9+ or GCC 9+
+* Clang 11+ or GCC 9+
 * [CMake 3.14.1+](https://www.cmake.org/download/)
-* [Qt 5.14+](https://www.qt.io/download-qt-installer)
+* [Qt 5.15.2](https://www.qt.io/download-qt-installer)
 * [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/linux/getting_started.html))
 * [SDL2](https://www.libsdl.org/download-2.0.php) (for the FAudio backend)
 
@@ -40,11 +40,11 @@ Ubuntu is usually horrendously out of date, and some packages need to be downloa
 
 Ubuntu usually does not have a new enough Qt package to suit rpcs3's needs. There is a PPA available to work around this. Run the following:
 ```
-ucodename=$(lsb_release -sc)
-sudo add-apt-repository ppa:beineri/opt-qt-5.14.1-$ucodename
+. /etc/os-release
+sudo add-apt-repository ppa:beineri/opt-qt-5.15.2-$UBUNTU_CODENAME
 sudo apt-get update
-. /opt/qt514/bin/qt514-env.sh >/dev/null 2>&1
-sudo apt-get install qt514-meta-minimal qt514svg
+sudo apt-get install qt515-meta-minimal qt515svg
+. /opt/qt515/bin/qt515-env.sh >/dev/null 2>&1
 ```
 
 ##### GCC 9.x installation
@@ -62,27 +62,27 @@ You can either use `update-alternatives` to setup `gcc-9`/`g++-9` as your defaul
 
 For Ubuntu systems, it is strongly recommended to use the PPA from [LunarG](https://packages.lunarg.com/) which will provide a compatible Vulkan SDK to compile RPCS3. If your Vulkan SDK is older, it can lead to compilation errors.
 ```
-ucodename=$(lsb_release -sc)
-wget -qO - http://packages.lunarg.com/lunarg-signing-key-pub.asc | sudo apt-key add -
-sudo wget -qO /etc/apt/sources.list.d/lunarg-vulkan-1.1.126-$ucodename.list http://packages.lunarg.com/vulkan/1.1.126/lunarg-vulkan-1.1.126-$ucodename.list
+. /etc/os-release
+wget -qO - https://packages.lunarg.com/lunarg-signing-key-pub.asc | sudo apt-key add -
+sudo wget -qO /etc/apt/sources.list.d/lunarg-vulkan-1.2.148-$UBUNTU_CODENAME.list https://packages.lunarg.com/vulkan/1.2.148/lunarg-vulkan-1.2.148-$UBUNTU_CODENAME.list
 sudo apt update
 sudo apt install vulkan-sdk
 ```
 
 ##### CMake
 ```
+. /etc/os-release
 wget -O - https://apt.kitware.com/keys/kitware-archive-latest.asc 2>/dev/null | sudo apt-key add -
-sudo apt-add-repository "deb https://apt.kitware.com/ubuntu/ $(lsb_release -sc) main"
+sudo apt-add-repository "deb https://apt.kitware.com/ubuntu/ $UBUNTU_CODENAME main"
 sudo apt-get update
 sudo apt-get install kitware-archive-keyring
 sudo apt-key --keyring /etc/apt/trusted.gpg del C1F34CDD40CD72DA
 sudo apt-get install cmake
-
 ```
 
 #### Fedora
 
-    sudo dnf install alsa-lib-devel cmake glew glew-devel libatomic libevdev-devel libudev-devel openal-devel qt5-devel vulkan-devel
+    sudo dnf install alsa-lib-devel cmake glew glew-devel libatomic libevdev-devel libudev-devel openal-devel qt5-devel qt5-qtbase-private-devel vulkan-devel
 
 #### OpenSUSE
 
@@ -103,7 +103,7 @@ git submodule update --init
 #### Configuring the Qt plugin (if used)
 
 1) Go to the Qt5 menu and edit Qt5 options.
-2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.14.1\msvc2017_64`.
+2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.15.2\msvc2019_64`.
 3) While selecting the rpcs3qt project, go to Qt5->Project Setting and select the version you added.
 
 #### Building the projects

CMakeLists.txt

@@ -7,8 +7,8 @@ if(CMAKE_COMPILER_IS_GNUCXX)
 		message(FATAL_ERROR "RPCS3 requires at least gcc-9.")
 	endif()
 elseif(${CMAKE_CXX_COMPILER_ID} MATCHES "Clang")
-	if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 9.0)
-		message(FATAL_ERROR "RPCS3 requires at least clang-9.0.")
+	if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 11.0)
+		message(FATAL_ERROR "RPCS3 requires at least clang-11.0.")
 	endif()
 endif()
 
@@ -22,7 +22,7 @@ option(USE_LIBEVDEV "libevdev-based joystick support" ON)
 option(USE_DISCORD_RPC "Discord rich presence integration" ON)
 option(USE_SYSTEM_ZLIB "Prefer system ZLIB instead of the builtin one" ON)
 option(USE_VULKAN "Vulkan render backend" ON)
-option(USE_PRECOMPILED_HEADERS "Use precompiled headers" ON)
+option(USE_PRECOMPILED_HEADERS "Use precompiled headers" OFF)
 
 set(CMAKE_MODULE_PATH "${CMAKE_CURRENT_LIST_DIR}/rpcs3/cmake_modules")
 
@@ -64,7 +64,7 @@ set(CMAKE_C_FLAGS -w)
 set(LLVM_ENABLE_WARNINGS OFF CACHE BOOL "")
 
 if(MSVC)
-	add_compile_options(/wd4530) # C++ exception handler used, but unwind semantics are not enabled
+	add_compile_options(/wd4530 /utf-8) # C++ exception handler used, but unwind semantics are not enabled
 endif()
 
 add_subdirectory(Vulkan EXCLUDE_FROM_ALL)

README.md

@@ -1,8 +1,9 @@
 RPCS3
 =====
 
-[![Build Status](https://travis-ci.org/RPCS3/rpcs3.svg?branch=master)](https://travis-ci.org/RPCS3/rpcs3)
-[![Build Status](https://dev.azure.com/nekotekina/nekotekina/_apis/build/status/RPCS3.rpcs3?branchName=master)](https://dev.azure.com/nekotekina/nekotekina/_build/latest?definitionId=4&branchName=master)
+[![Azure Build Status](https://dev.azure.com/nekotekina/nekotekina/_apis/build/status/RPCS3.rpcs3?branchName=master)](https://dev.azure.com/nekotekina/nekotekina/_build?definitionId=4&branchName=master)
+[![Cirrus CI - Base Branch Build Status](https://img.shields.io/cirrus/github/RPCS3/rpcs3?label=Cirrus%20CI%20(FreeBSD)&logo=cirrus-ci)](https://cirrus-ci.com/github/RPCS3/rpcs3)
+[![RPCS3 discord server](https://img.shields.io/discord/272035812277878785?color=%237289DA&label=RPCS3%20Discord&logo=discord&logoColor=white)](https://discord.me/rpcs3)
 
 The world's first free and open-source PlayStation 3 emulator/debugger, written in C++ for Windows and Linux.
 

Utilities/BEType.h

@@ -1,467 +0,0 @@
-#pragma once
-
-#include "types.h"
-#include "util/endian.hpp"
-#include <cstring>
-
-#if __has_include(<bit>)
-#include <bit>
-#else
-#include <type_traits>
-#endif
-
-// 128-bit vector type and also se_storage<> storage type
-union alignas(16) v128
-{
-	char _bytes[16];
-
-	template <typename T, std::size_t N, std::size_t M>
-	struct masked_array_t // array type accessed as (index ^ M)
-	{
-		char m_data[16];
-
-	public:
-		T& operator[](std::size_t index)
-		{
-			return reinterpret_cast<T*>(m_data)[index ^ M];
-		}
-
-		const T& operator[](std::size_t index) const
-		{
-			return reinterpret_cast<const T*>(m_data)[index ^ M];
-		}
-	};
-
-	template <typename T, std::size_t N = 16 / sizeof(T)>
-	using normal_array_t = masked_array_t<T, N, std::endian::little == std::endian::native ? 0 : N - 1>;
-	template <typename T, std::size_t N = 16 / sizeof(T)>
-	using reversed_array_t = masked_array_t<T, N, std::endian::little == std::endian::native ? N - 1 : 0>;
-
-	normal_array_t<u64> _u64;
-	normal_array_t<s64> _s64;
-	reversed_array_t<u64> u64r;
-	reversed_array_t<s64> s64r;
-
-	normal_array_t<u32> _u32;
-	normal_array_t<s32> _s32;
-	reversed_array_t<u32> u32r;
-	reversed_array_t<s32> s32r;
-
-	normal_array_t<u16> _u16;
-	normal_array_t<s16> _s16;
-	reversed_array_t<u16> u16r;
-	reversed_array_t<s16> s16r;
-
-	normal_array_t<u8> _u8;
-	normal_array_t<s8> _s8;
-	reversed_array_t<u8> u8r;
-	reversed_array_t<s8> s8r;
-
-	normal_array_t<f32> _f;
-	normal_array_t<f64> _d;
-	reversed_array_t<f32> fr;
-	reversed_array_t<f64> dr;
-
-	__m128 vf;
-	__m128i vi;
-	__m128d vd;
-
-	struct bit_array_128
-	{
-		char m_data[16];
-
-	public:
-		class bit_element
-		{
-			u64& data;
-			const u64 mask;
-
-		public:
-			bit_element(u64& data, const u64 mask)
-				: data(data)
-				, mask(mask)
-			{
-			}
-
-			operator bool() const
-			{
-				return (data & mask) != 0;
-			}
-
-			bit_element& operator=(const bool right)
-			{
-				if (right)
-				{
-					data |= mask;
-				}
-				else
-				{
-					data &= ~mask;
-				}
-				return *this;
-			}
-
-			bit_element& operator=(const bit_element& right)
-			{
-				if (right)
-				{
-					data |= mask;
-				}
-				else
-				{
-					data &= ~mask;
-				}
-				return *this;
-			}
-		};
-
-		// Index 0 returns the MSB and index 127 returns the LSB
-		bit_element operator[](u32 index)
-		{
-			const auto data_ptr = reinterpret_cast<u64*>(m_data);
-
-			if constexpr (std::endian::little == std::endian::native)
-			{
-				return bit_element(data_ptr[1 - (index >> 6)], 0x8000000000000000ull >> (index & 0x3F));
-			}
-			else
-			{
-				return bit_element(data_ptr[index >> 6], 0x8000000000000000ull >> (index & 0x3F));
-			}
-		}
-
-		// Index 0 returns the MSB and index 127 returns the LSB
-		bool operator[](u32 index) const
-		{
-			const auto data_ptr = reinterpret_cast<const u64*>(m_data);
-
-			if constexpr (std::endian::little == std::endian::native)
-			{
-				return (data_ptr[1 - (index >> 6)] & (0x8000000000000000ull >> (index & 0x3F))) != 0;
-			}
-			else
-			{
-				return (data_ptr[index >> 6] & (0x8000000000000000ull >> (index & 0x3F))) != 0;
-			}
-		}
-	} _bit;
-
-	static v128 from64(u64 _0, u64 _1 = 0)
-	{
-		v128 ret;
-		ret._u64[0] = _0;
-		ret._u64[1] = _1;
-		return ret;
-	}
-
-	static v128 from64r(u64 _1, u64 _0 = 0)
-	{
-		return from64(_0, _1);
-	}
-
-	static v128 from32(u32 _0, u32 _1 = 0, u32 _2 = 0, u32 _3 = 0)
-	{
-		v128 ret;
-		ret._u32[0] = _0;
-		ret._u32[1] = _1;
-		ret._u32[2] = _2;
-		ret._u32[3] = _3;
-		return ret;
-	}
-
-	static v128 from32r(u32 _3, u32 _2 = 0, u32 _1 = 0, u32 _0 = 0)
-	{
-		return from32(_0, _1, _2, _3);
-	}
-
-	static v128 from32p(u32 value)
-	{
-		v128 ret;
-		ret.vi = _mm_set1_epi32(static_cast<s32>(value));
-		return ret;
-	}
-
-	static v128 from16p(u16 value)
-	{
-		v128 ret;
-		ret.vi = _mm_set1_epi16(static_cast<s16>(value));
-		return ret;
-	}
-
-	static v128 from8p(u8 value)
-	{
-		v128 ret;
-		ret.vi = _mm_set1_epi8(static_cast<s8>(value));
-		return ret;
-	}
-
-	static v128 fromBit(u32 bit)
-	{
-		v128 ret = {};
-		ret._bit[bit] = true;
-		return ret;
-	}
-
-	static v128 fromV(__m128i value)
-	{
-		v128 ret;
-		ret.vi = value;
-		return ret;
-	}
-
-	static v128 fromF(__m128 value)
-	{
-		v128 ret;
-		ret.vf = value;
-		return ret;
-	}
-
-	static v128 fromD(__m128d value)
-	{
-		v128 ret;
-		ret.vd = value;
-		return ret;
-	}
-
-	// Unaligned load with optional index offset
-	static v128 loadu(const void* ptr, std::size_t index = 0)
-	{
-		v128 ret;
-		std::memcpy(&ret, static_cast<const u8*>(ptr) + index * sizeof(v128), sizeof(v128));
-		return ret;
-	}
-
-	// Unaligned store with optional index offset
-	static void storeu(v128 value, void* ptr, std::size_t index = 0)
-	{
-		std::memcpy(static_cast<u8*>(ptr) + index * sizeof(v128), &value, sizeof(v128));
-	}
-
-	static inline v128 add8(const v128& left, const v128& right)
-	{
-		return fromV(_mm_add_epi8(left.vi, right.vi));
-	}
-
-	static inline v128 add16(const v128& left, const v128& right)
-	{
-		return fromV(_mm_add_epi16(left.vi, right.vi));
-	}
-
-	static inline v128 add32(const v128& left, const v128& right)
-	{
-		return fromV(_mm_add_epi32(left.vi, right.vi));
-	}
-
-	static inline v128 addfs(const v128& left, const v128& right)
-	{
-		return fromF(_mm_add_ps(left.vf, right.vf));
-	}
-
-	static inline v128 addfd(const v128& left, const v128& right)
-	{
-		return fromD(_mm_add_pd(left.vd, right.vd));
-	}
-
-	static inline v128 sub8(const v128& left, const v128& right)
-	{
-		return fromV(_mm_sub_epi8(left.vi, right.vi));
-	}
-
-	static inline v128 sub16(const v128& left, const v128& right)
-	{
-		return fromV(_mm_sub_epi16(left.vi, right.vi));
-	}
-
-	static inline v128 sub32(const v128& left, const v128& right)
-	{
-		return fromV(_mm_sub_epi32(left.vi, right.vi));
-	}
-
-	static inline v128 subfs(const v128& left, const v128& right)
-	{
-		return fromF(_mm_sub_ps(left.vf, right.vf));
-	}
-
-	static inline v128 subfd(const v128& left, const v128& right)
-	{
-		return fromD(_mm_sub_pd(left.vd, right.vd));
-	}
-
-	static inline v128 maxu8(const v128& left, const v128& right)
-	{
-		return fromV(_mm_max_epu8(left.vi, right.vi));
-	}
-
-	static inline v128 minu8(const v128& left, const v128& right)
-	{
-		return fromV(_mm_min_epu8(left.vi, right.vi));
-	}
-
-	static inline v128 eq8(const v128& left, const v128& right)
-	{
-		return fromV(_mm_cmpeq_epi8(left.vi, right.vi));
-	}
-
-	static inline v128 eq16(const v128& left, const v128& right)
-	{
-		return fromV(_mm_cmpeq_epi16(left.vi, right.vi));
-	}
-
-	static inline v128 eq32(const v128& left, const v128& right)
-	{
-		return fromV(_mm_cmpeq_epi32(left.vi, right.vi));
-	}
-
-	bool operator==(const v128& right) const
-	{
-		return _u64[0] == right._u64[0] && _u64[1] == right._u64[1];
-	}
-
-	bool operator!=(const v128& right) const
-	{
-		return _u64[0] != right._u64[0] || _u64[1] != right._u64[1];
-	}
-
-	// result = (~left) & (right)
-	static inline v128 andnot(const v128& left, const v128& right)
-	{
-		return fromV(_mm_andnot_si128(left.vi, right.vi));
-	}
-
-	void clear()
-	{
-		_u64[0] = 0;
-		_u64[1] = 0;
-	}
-};
-
-template <typename T, std::size_t N, std::size_t M>
-struct offset32_array<v128::masked_array_t<T, N, M>>
-{
-	template <typename Arg>
-	static inline u32 index32(const Arg& arg)
-	{
-		return u32{sizeof(T)} * (static_cast<u32>(arg) ^ static_cast<u32>(M));
-	}
-};
-
-inline v128 operator|(const v128& left, const v128& right)
-{
-	return v128::fromV(_mm_or_si128(left.vi, right.vi));
-}
-
-inline v128 operator&(const v128& left, const v128& right)
-{
-	return v128::fromV(_mm_and_si128(left.vi, right.vi));
-}
-
-inline v128 operator^(const v128& left, const v128& right)
-{
-	return v128::fromV(_mm_xor_si128(left.vi, right.vi));
-}
-
-inline v128 operator~(const v128& other)
-{
-	return v128::from64(~other._u64[0], ~other._u64[1]);
-}
-
-using stx::se_t;
-using stx::se_storage;
-
-// se_t<> with native endianness
-template <typename T, std::size_t Align = alignof(T)>
-using nse_t = se_t<T, false, Align>;
-
-template <typename T, std::size_t Align = alignof(T)>
-using be_t = se_t<T, std::endian::little == std::endian::native, Align>;
-template <typename T, std::size_t Align = alignof(T)>
-using le_t = se_t<T, std::endian::big == std::endian::native, Align>;
-
-// Type converter: converts native endianness arithmetic/enum types to appropriate se_t<> type
-template <typename T, bool Se, typename = void>
-struct to_se
-{
-	template <typename T2, typename = void>
-	struct to_se_
-	{
-		using type = T2;
-	};
-
-	template <typename T2>
-	struct to_se_<T2, std::enable_if_t<std::is_arithmetic<T2>::value || std::is_enum<T2>::value>>
-	{
-		using type = std::conditional_t<(sizeof(T2) > 1), se_t<T2, Se>, T2>;
-	};
-
-	// Convert arithmetic and enum types
-	using type = typename to_se_<T>::type;
-};
-
-template <bool Se>
-struct to_se<v128, Se>
-{
-	using type = se_t<v128, Se>;
-};
-
-template <bool Se>
-struct to_se<u128, Se>
-{
-	using type = se_t<u128, Se>;
-};
-
-template <bool Se>
-struct to_se<s128, Se>
-{
-	using type = se_t<s128, Se>;
-};
-
-template <typename T, bool Se>
-struct to_se<const T, Se, std::enable_if_t<!std::is_array<T>::value>>
-{
-	// Move const qualifier
-	using type = const typename to_se<T, Se>::type;
-};
-
-template <typename T, bool Se>
-struct to_se<volatile T, Se, std::enable_if_t<!std::is_array<T>::value && !std::is_const<T>::value>>
-{
-	// Move volatile qualifier
-	using type = volatile typename to_se<T, Se>::type;
-};
-
-template <typename T, bool Se>
-struct to_se<T[], Se>
-{
-	// Move array qualifier
-	using type = typename to_se<T, Se>::type[];
-};
-
-template <typename T, bool Se, std::size_t N>
-struct to_se<T[N], Se>
-{
-	// Move array qualifier
-	using type = typename to_se<T, Se>::type[N];
-};
-
-// BE/LE aliases for to_se<>
-template <typename T>
-using to_be_t = typename to_se<T, std::endian::little == std::endian::native>::type;
-template <typename T>
-using to_le_t = typename to_se<T, std::endian::big == std::endian::native>::type;
-
-// BE/LE aliases for atomic_t
-template <typename T>
-using atomic_be_t = atomic_t<be_t<T>>;
-template <typename T>
-using atomic_le_t = atomic_t<le_t<T>>;
-
-template <typename T, bool Se, std::size_t Align>
-struct fmt_unveil<se_t<T, Se, Align>, void>
-{
-	using type = typename fmt_unveil<T>::type;
-
-	static inline auto get(const se_t<T, Se, Align>& arg)
-	{
-		return fmt_unveil<T>::get(arg);
-	}
-};

Utilities/BitField.h

@@ -1,6 +1,7 @@
-#pragma once
+#pragma once
 
-#include "types.h"
+#include "util/types.hpp"
+#include "Utilities/StrFmt.h"
 
 template<typename T, uint N>
 struct bf_base
@@ -147,7 +148,7 @@ struct bf_t : bf_base<T, N>
 
 	bf_t& operator &=(vtype right)
 	{
-		this->m_data &= static_cast<vtype>((static_cast<utype>(right) & bf_t::vmask) << bitpos);
+		this->m_data &= static_cast<vtype>(((static_cast<utype>(right) & bf_t::vmask) << bitpos) | ~(bf_t::vmask << bitpos));
 		return *this;
 	}
 

Utilities/CPUStats.h

@@ -1,6 +1,6 @@
 #pragma once
 
-#include <Utilities/types.h>
+#include "util/types.hpp"
 
 #ifdef _WIN32
 #include "windows.h"
@@ -176,7 +176,7 @@ public:
 		};
 		u_int miblen = std::size(mib);
 		struct kinfo_proc info;
-		size_t size = sizeof(info);
+		usz size = sizeof(info);
 		if (sysctl(mib, miblen, &info, &size, NULL, 0))
 		{
 			return 0;
@@ -194,7 +194,7 @@ public:
 		u_int miblen = std::size(mib);
 
 		// get number of structs
-		size_t size;
+		usz size;
 		if (sysctl(mib, miblen, NULL, &size, NULL, 0))
 		{
 			return 0;

Utilities/Config.cpp

@@ -1,14 +1,12 @@
-#include "stdafx.h"
+#include "stdafx.h"
 #include "Config.h"
-#include "Utilities/types.h"
+#include "util/types.hpp"
 
 #include "util/yaml.hpp"
 
 #include <typeinfo>
 #include <charconv>
 
-[[noreturn]] void report_fatal_error(const std::string&);
-
 LOG_CHANNEL(cfg_log, "CFG");
 
 namespace cfg
@@ -18,7 +16,7 @@ namespace cfg
 	{
 		if (_type != type::node)
 		{
-			cfg_log.fatal("Invalid root node" HERE);
+			cfg_log.fatal("Invalid root node");
 		}
 	}
 
@@ -29,7 +27,7 @@ namespace cfg
 		{
 			if (pair.first == name)
 			{
-				cfg_log.fatal("Node already exists: %s" HERE, name);
+				cfg_log.fatal("Node already exists: %s", name);
 			}
 		}
 
@@ -38,12 +36,12 @@ namespace cfg
 
 	bool _base::from_string(const std::string&, bool)
 	{
-		report_fatal_error("from_string() purecall" HERE);
+		fmt::throw_exception("from_string() purecall");
 	}
 
 	bool _base::from_list(std::vector<std::string>&&)
 	{
-		report_fatal_error("from_list() purecall" HERE);
+		fmt::throw_exception("from_list() purecall");
 	}
 
 	// Emit YAML
@@ -65,6 +63,13 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
 	const char* start = &value.front();
 	const char* end = &value.back() + 1;
 	int base = 10;
+	int sign = +1;
+
+	if (start[0] == '-')
+	{
+		sign = -1;
+		start += 1;
+	}
 
 	if (start[0] == '0' && (start[1] == 'x' || start[1] == 'X'))
 	{
@@ -75,15 +80,17 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
 
 	const auto ret = std::from_chars(start, end, result, base);
 
-	if (ret.ec != std::errc() || ret.ptr != end)
+	if (ret.ec != std::errc() || ret.ptr != end || (start[0] == '-' && sign < 0))
 	{
-		if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value);
+		if (out) cfg_log.error("cfg::try_to_int64('%s'): invalid integer", value);
 		return false;
 	}
 
+	result *= sign;
+
 	if (result < min || result > max)
 	{
-		if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%d..%d)", value, min, max);
+		if (out) cfg_log.error("cfg::try_to_int64('%s'): out of bounds (%d..%d)", value, min, max);
 		return false;
 	}
 
@@ -114,13 +121,13 @@ bool cfg::try_to_uint64(u64* out, const std::string& value, u64 min, u64 max)
 
 	if (ret.ec != std::errc() || ret.ptr != end)
 	{
-		if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value);
+		if (out) cfg_log.error("cfg::try_to_uint64('%s'): invalid integer", value);
 		return false;
 	}
 
 	if (result < min || result > max)
 	{
-		if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%u..%u)", value, min, max);
+		if (out) cfg_log.error("cfg::try_to_uint64('%s'): out of bounds (%u..%u)", value, min, max);
 		return false;
 	}
 
@@ -371,7 +378,7 @@ void cfg::_bool::from_default()
 
 void cfg::string::from_default()
 {
-	m_value = m_value.make(def);
+	m_value = def;
 }
 
 void cfg::set_entry::from_default()

Utilities/Config.h

@@ -1,10 +1,10 @@
-#pragma once
+#pragma once
 
-#include "Utilities/types.h"
+#include "util/types.hpp"
 #include "Utilities/StrFmt.h"
 #include "util/logs.hpp"
 #include "util/atomic.hpp"
-#include "util/shared_cptr.hpp"
+#include "util/shared_ptr.hpp"
 
 #include <utility>
 #include <string>
@@ -203,6 +203,11 @@ namespace cfg
 			return m_value;
 		}
 
+		void set(T value)
+		{
+			m_value = value;
+		}
+
 		void from_default() override
 		{
 			m_value = def;
@@ -384,11 +389,11 @@ namespace cfg
 	using uint64 = uint<0, UINT64_MAX>;
 
 	// Simple string entry with mutex
-	class string final : public _base
+	class string : public _base
 	{
 		const std::string m_name;
 
-		stx::atomic_cptr<std::string> m_value;
+		atomic_ptr<std::string> m_value;
 
 	public:
 		std::string def;
@@ -396,7 +401,7 @@ namespace cfg
 		string(node* owner, std::string name, std::string def = {}, bool dynamic = false)
 			: _base(type::string, owner, name, dynamic)
 			, m_name(std::move(name))
-			, m_value(m_value.make(def))
+			, m_value(def)
 			, def(std::move(def))
 		{
 		}
@@ -406,7 +411,7 @@ namespace cfg
 			return *m_value.load().get();
 		}
 
-		std::pair<const std::string&, stx::shared_cptr<std::string>> get() const
+		std::pair<const std::string&, shared_ptr<std::string>> get() const
 		{
 			auto v = m_value.load();
 
@@ -435,7 +440,7 @@ namespace cfg
 
 		bool from_string(const std::string& value, bool /*dynamic*/ = false) override
 		{
-			m_value = m_value.make(value);
+			m_value = value;
 			return true;
 		}
 	};

Utilities/File.cpp

@@ -1,7 +1,6 @@
-#include "File.h"
+#include "File.h"
 #include "mutex.h"
 #include "StrFmt.h"
-#include "BEType.h"
 #include "Crypto/sha1.h"
 
 #include <unordered_map>
@@ -11,6 +10,8 @@
 #include <typeinfo>
 #include <map>
 
+#include "util/asm.hpp"
+
 using namespace std::literals::string_literals;
 
 #ifdef _WIN32
@@ -21,10 +22,10 @@ using namespace std::literals::string_literals;
 static std::unique_ptr<wchar_t[]> to_wchar(const std::string& source)
 {
 	// String size + null terminator
-	const std::size_t buf_size = source.size() + 1;
+	const usz buf_size = source.size() + 1;
 
 	// Safe size
-	const int size = narrow<int>(buf_size, "to_wchar" HERE);
+	const int size = narrow<int>(buf_size);
 
 	// Buffer for max possible output length
 	std::unique_ptr<wchar_t[]> buffer(new wchar_t[buf_size + 8 + 32768]);
@@ -41,10 +42,10 @@ static std::unique_ptr<wchar_t[]> to_wchar(const std::string& source)
 		std::memcpy(buffer.get() + 32768 + 4, L"UNC\\", 4 * sizeof(wchar_t));
 	}
 
-	verify("to_wchar" HERE), MultiByteToWideChar(CP_UTF8, 0, source.c_str(), size, buffer.get() + 32768 + (unc ? 8 : 4), size);
+	ensure(MultiByteToWideChar(CP_UTF8, 0, source.c_str(), size, buffer.get() + 32768 + (unc ? 8 : 4), size)); // "to_wchar"
 
 	// Canonicalize wide path (replace '/', ".", "..", \\ repetitions, etc)
-	verify("to_wchar" HERE), GetFullPathNameW(buffer.get() + 32768, 32768, buffer.get(), nullptr) - 1 < 32768 - 1;
+	ensure(GetFullPathNameW(buffer.get() + 32768, 32768, buffer.get(), nullptr) - 1 < 32768 - 1); // "to_wchar"
 
 	return buffer;
 }
@@ -52,10 +53,10 @@ static std::unique_ptr<wchar_t[]> to_wchar(const std::string& source)
 static void to_utf8(std::string& out, const wchar_t* source)
 {
 	// String size
-	const std::size_t length = std::wcslen(source);
+	const usz length = std::wcslen(source);
 
 	// Safe buffer size for max possible output length (including null terminator)
-	const int buf_size = narrow<int>(length * 3 + 1, "to_utf8" HERE);
+	const int buf_size = narrow<int>(length * 3 + 1);
 
 	// Resize buffer
 	out.resize(buf_size - 1);
@@ -63,7 +64,7 @@ static void to_utf8(std::string& out, const wchar_t* source)
 	const int result = WideCharToMultiByte(CP_UTF8, 0, source, static_cast<int>(length) + 1, &out.front(), buf_size, NULL, NULL);
 
 	// Fix the size
-	out.resize(verify("to_utf8" HERE, result) - 1);
+	out.resize(ensure(result) - 1);
 }
 
 static time_t to_time(const ULARGE_INTEGER& ft)
@@ -129,6 +130,7 @@ static fs::error to_error(DWORD e)
 	case ERROR_DIR_NOT_EMPTY: return fs::error::notempty;
 	case ERROR_NOT_READY: return fs::error::noent;
 	case ERROR_FILENAME_EXCED_RANGE: return fs::error::toolong;
+	case ERROR_DISK_FULL: return fs::error::nospace;
 	default: return fs::error::unknown;
 	}
 }
@@ -170,6 +172,7 @@ static fs::error to_error(int e)
 	case ENOTEMPTY: return fs::error::notempty;
 	case EROFS: return fs::error::readonly;
 	case EISDIR: return fs::error::isdir;
+	case ENOSPC: return fs::error::nospace;
 	default: return fs::error::unknown;
 	}
 }
@@ -180,7 +183,7 @@ static std::string path_append(std::string_view path, std::string_view more)
 {
 	std::string result;
 
-	if (const size_t src_slash_pos = path.find_last_not_of('/'); src_slash_pos != path.npos)
+	if (const usz src_slash_pos = path.find_last_not_of('/'); src_slash_pos != path.npos)
 	{
 		path.remove_suffix(path.length() - src_slash_pos - 1);
 		result = path;
@@ -188,7 +191,7 @@ static std::string path_append(std::string_view path, std::string_view more)
 
 	result.push_back('/');
 
-	if (const size_t dst_slash_pos = more.find_first_not_of('/'); dst_slash_pos != more.npos)
+	if (const usz dst_slash_pos = more.find_first_not_of('/'); dst_slash_pos != more.npos)
 	{
 		more.remove_prefix(dst_slash_pos);
 		result.append(more);
@@ -313,33 +316,19 @@ std::shared_ptr<fs::device_base> fs::get_virtual_device(const std::string& path)
 
 std::shared_ptr<fs::device_base> fs::set_virtual_device(const std::string& name, const std::shared_ptr<device_base>& device)
 {
-	verify(HERE), name.starts_with("//"), name[2] != '/';
+	ensure(name.starts_with("//") && name[2] != '/');
 
 	return get_device_manager().set_device(name, device);
 }
 
 std::string fs::get_parent_dir(const std::string& path)
 {
-	// Search upper bound (set to the last character, npos for empty string)
-	auto last = path.size() - 1;
+	// Get (basically) processed path
+	const auto real_path = fs::escape_path(path);
 
-#ifdef _WIN32
-	const auto& delim = "/\\";
-#else
-	const auto& delim = "/";
-#endif
+	const auto pos = real_path.find_last_of(delim);
 
-	while (true)
-	{
-		const auto pos = path.find_last_of(delim, last, sizeof(delim) - 1);
-
-		// Contiguous slashes are ignored at the end
-		if (std::exchange(last, pos - 1) != pos)
-		{
-			// Return empty string if the path doesn't contain at least 2 elements
-			return path.substr(0, pos != umax && path.find_last_not_of(delim, pos, sizeof(delim) - 1) != umax ? pos : 0);
-		}
-	}
+	return real_path.substr(0, pos == umax ? 0 : pos);
 }
 
 bool fs::stat(const std::string& path, stat_t& info)
@@ -350,16 +339,83 @@ bool fs::stat(const std::string& path, stat_t& info)
 	}
 
 #ifdef _WIN32
-	WIN32_FILE_ATTRIBUTE_DATA attrs;
-	if (!GetFileAttributesExW(to_wchar(path).get(), GetFileExInfoStandard, &attrs))
+	std::string_view epath = path;
+
+	// '/' and '\\' Not allowed by FindFirstFileExW at the end of path but we should allow it
+	if (auto not_del = epath.find_last_not_of(delim); not_del != umax && not_del != epath.size() - 1)
+	{
+		epath.remove_suffix(epath.size() - 1 - not_del);
+	}
+
+	// Handle drives specially
+	if (epath.find_first_of(delim) == umax && epath.ends_with(':'))
+	{
+		WIN32_FILE_ATTRIBUTE_DATA attrs;
+
+		// Must end with a delimiter
+		if (!GetFileAttributesExW(to_wchar(std::string(epath) + '/').get(), GetFileExInfoStandard, &attrs))
+		{
+			g_tls_error = to_error(GetLastError());
+			return false;
+		}
+
+		info.is_directory = true; // Handle drives as directories
+		info.is_writable = (attrs.dwFileAttributes & FILE_ATTRIBUTE_READONLY) == 0;
+		info.size = attrs.nFileSizeLow | (u64{attrs.nFileSizeHigh} << 32);
+		info.atime = to_time(attrs.ftLastAccessTime);
+		info.mtime = to_time(attrs.ftLastWriteTime);
+		info.ctime = info.mtime;
+
+		if (info.atime < info.mtime)
+			info.atime = info.mtime;
+
+		return true;
+	}
+
+	WIN32_FIND_DATA attrs;
+
+	// Allowed by FindFirstFileExW but we should not allow it
+	if (epath.ends_with("*"))
+	{
+		g_tls_error = fs::error::noent;
+		return false;
+	}
+
+	const auto wchar_ptr = to_wchar(std::string(epath));
+	const std::wstring_view wpath_view = wchar_ptr.get();
+
+	const HANDLE handle = FindFirstFileExW(wpath_view.data(), FindExInfoStandard, &attrs, FindExSearchNameMatch, nullptr, FIND_FIRST_EX_CASE_SENSITIVE);
+
+	if (handle == INVALID_HANDLE_VALUE)
 	{
 		g_tls_error = to_error(GetLastError());
 		return false;
 	}
 
+	struct close_t
+	{
+		HANDLE handle;
+		~close_t() { FindClose(handle); }
+	};
+
+	for (close_t find_manage{handle}; attrs.cFileName != wpath_view.substr(wpath_view.find_last_of(wdelim) + 1);)
+	{
+		if (!FindNextFileW(handle, &attrs))
+		{
+			if (const DWORD err = GetLastError(); err != ERROR_NO_MORE_FILES)
+			{
+				g_tls_error = to_error(err);
+				return false;
+			}
+
+			g_tls_error = fs::error::noent;
+			return false;
+		}
+	}
+
 	info.is_directory = (attrs.dwFileAttributes & FILE_ATTRIBUTE_DIRECTORY) != 0;
 	info.is_writable = (attrs.dwFileAttributes & FILE_ATTRIBUTE_READONLY) == 0;
-	info.size = (u64)attrs.nFileSizeLow | ((u64)attrs.nFileSizeHigh << 32);
+	info.size = attrs.nFileSizeLow | (u64{attrs.nFileSizeHigh} << 32);
 	info.atime = to_time(attrs.ftLastAccessTime);
 	info.mtime = to_time(attrs.ftLastWriteTime);
 	info.ctime = info.mtime;
@@ -387,73 +443,19 @@ bool fs::stat(const std::string& path, stat_t& info)
 
 bool fs::exists(const std::string& path)
 {
-	if (auto device = get_virtual_device(path))
-	{
-		stat_t info;
-		return device->stat(path, info);
-	}
-
-#ifdef _WIN32
-	if (GetFileAttributesW(to_wchar(path).get()) == INVALID_FILE_ATTRIBUTES)
-	{
-		g_tls_error = to_error(GetLastError());
-		return false;
-	}
-
-	return true;
-#else
-	struct ::stat file_info;
-	if (::stat(path.c_str(), &file_info) != 0)
-	{
-		g_tls_error = to_error(errno);
-		return false;
-	}
-
-	return true;
-#endif
+	fs::stat_t info{};
+	return fs::stat(path, info);
 }
 
 bool fs::is_file(const std::string& path)
 {
-	if (auto device = get_virtual_device(path))
+	fs::stat_t info{};
+	if (!fs::stat(path, info))
 	{
-		stat_t info;
-		if (!device->stat(path, info))
-		{
-			return false;
-		}
-
-		if (info.is_directory)
-		{
-			g_tls_error = error::exist;
-			return false;
-		}
-
-		return true;
-	}
-
-#ifdef _WIN32
-	const DWORD attrs = GetFileAttributesW(to_wchar(path).get());
-	if (attrs == INVALID_FILE_ATTRIBUTES)
-	{
-		g_tls_error = to_error(GetLastError());
 		return false;
 	}
-#else
-	struct ::stat file_info;
-	if (::stat(path.c_str(), &file_info) != 0)
-	{
-		g_tls_error = to_error(errno);
-		return false;
-	}
-#endif
 
-	// TODO: correct file type check
-#ifdef _WIN32
-	if ((attrs & FILE_ATTRIBUTE_DIRECTORY) != 0)
-#else
-	if (S_ISDIR(file_info.st_mode))
-#endif
+	if (info.is_directory)
 	{
 		g_tls_error = error::exist;
 		return false;
@@ -464,44 +466,13 @@ bool fs::is_file(const std::string& path)
 
 bool fs::is_dir(const std::string& path)
 {
-	if (auto device = get_virtual_device(path))
+	fs::stat_t info{};
+	if (!fs::stat(path, info))
 	{
-		stat_t info;
-		if (!device->stat(path, info))
-		{
-			return false;
-		}
-
-		if (info.is_directory == false)
-		{
-			g_tls_error = error::exist;
-			return false;
-		}
-
-		return true;
-	}
-
-#ifdef _WIN32
-	const DWORD attrs = GetFileAttributesW(to_wchar(path).get());
-	if (attrs == INVALID_FILE_ATTRIBUTES)
-	{
-		g_tls_error = to_error(GetLastError());
 		return false;
 	}
-#else
-	struct ::stat file_info;
-	if (::stat(path.c_str(), &file_info) != 0)
-	{
-		g_tls_error = to_error(errno);
-		return false;
-	}
-#endif
 
-#ifdef _WIN32
-	if ((attrs & FILE_ATTRIBUTE_DIRECTORY) == 0)
-#else
-	if (!S_ISDIR(file_info.st_mode))
-#endif
+	if (!info.is_directory)
 	{
 		g_tls_error = error::exist;
 		return false;
@@ -536,7 +507,7 @@ bool fs::statfs(const std::string& path, fs::device_stat& info)
 	// Keep cutting path from right until it's short enough
 	while (str.size() > 256)
 	{
-		if (std::size_t x = str.find_last_of('\\') + 1)
+		if (usz x = str.find_last_of('\\') + 1)
 			str.resize(x - 1);
 		else
 			break;
@@ -779,7 +750,7 @@ bool fs::copy_file(const std::string& from, const std::string& to, bool overwrit
 	// sendfile will work with non-socket output (i.e. regular file) on Linux 2.6.33+
 	off_t bytes_copied = 0;
 	struct ::stat fileinfo = { 0 };
-	if (::fstat(input, &fileinfo) || ::sendfile(output, input, &bytes_copied, fileinfo.st_size))
+	if (::fstat(input, &fileinfo) == -1 || ::sendfile(output, input, &bytes_copied, fileinfo.st_size) == -1)
 #else
 #error "Native file copy implementation is missing"
 #endif
@@ -897,7 +868,7 @@ bool fs::utime(const std::string& path, s64 atime, s64 mtime)
 
 #ifdef _WIN32
 	// Open the file
-	const auto handle = CreateFileW(to_wchar(path).get(), FILE_WRITE_ATTRIBUTES, FILE_SHARE_READ | FILE_SHARE_WRITE | FILE_SHARE_DELETE, NULL, OPEN_EXISTING, FILE_ATTRIBUTE_NORMAL, NULL);
+	const auto handle = CreateFileW(to_wchar(path).get(), FILE_WRITE_ATTRIBUTES, FILE_SHARE_READ | FILE_SHARE_WRITE | FILE_SHARE_DELETE, NULL, OPEN_EXISTING, FILE_FLAG_BACKUP_SEMANTICS | FILE_ATTRIBUTE_NORMAL, NULL);
 	if (handle == INVALID_HANDLE_VALUE)
 	{
 		g_tls_error = to_error(GetLastError());
@@ -930,14 +901,19 @@ bool fs::utime(const std::string& path, s64 atime, s64 mtime)
 #endif
 }
 
-void fs::file::xnull() const
+[[noreturn]] void fs::xnull(const src_loc& loc)
 {
-	fmt::throw_exception("fs::file is null");
+	fmt::throw_exception("Null object.%s", loc);
 }
 
-void fs::file::xfail() const
+[[noreturn]] void fs::xfail(const src_loc& loc)
 {
-	fmt::throw_exception("Unexpected fs::error %s", g_tls_error);
+	fmt::throw_exception("Unexpected fs::error %s%s", g_tls_error, loc);
+}
+
+[[noreturn]] void fs::xovfl()
+{
+	fmt::throw_exception("Stream overflow.");
 }
 
 fs::file::file(const std::string& path, bs_t<open_mode> mode)
@@ -983,7 +959,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		disp = mode & fs::trunc ? TRUNCATE_EXISTING : OPEN_EXISTING;
 	}
 
-	DWORD share = 0;
+	DWORD share = FILE_SHARE_DELETE;
 	if (!(mode & fs::unread) || !(mode & fs::write))
 	{
 		share |= FILE_SHARE_READ;
@@ -991,7 +967,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 
 	if (!(mode & (fs::lock + fs::unread)) || !(mode & fs::write))
 	{
-		share |= FILE_SHARE_WRITE | FILE_SHARE_DELETE;
+		share |= FILE_SHARE_WRITE;
 	}
 
 	const HANDLE handle = CreateFileW(to_wchar(path).get(), access, share, NULL, disp, FILE_ATTRIBUTE_NORMAL, NULL);
@@ -1020,7 +996,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		stat_t stat() override
 		{
 			FILE_BASIC_INFO basic_info;
-			verify("file::stat" HERE), GetFileInformationByHandleEx(m_handle, FileBasicInfo, &basic_info, sizeof(FILE_BASIC_INFO));
+			ensure(GetFileInformationByHandleEx(m_handle, FileBasicInfo, &basic_info, sizeof(FILE_BASIC_INFO))); // "file::stat"
 
 			stat_t info;
 			info.is_directory = (basic_info.FileAttributes & FILE_ATTRIBUTE_DIRECTORY) != 0;
@@ -1038,7 +1014,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 
 		void sync() override
 		{
-			verify("file::sync" HERE), FlushFileBuffers(m_handle);
+			ensure(FlushFileBuffers(m_handle)); // "file::sync"
 		}
 
 		bool trunc(u64 length) override
@@ -1058,10 +1034,10 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 read(void* buffer, u64 count) override
 		{
 			// TODO (call ReadFile multiple times if count is too big)
-			const int size = narrow<int>(count, "file::read" HERE);
+			const int size = narrow<int>(count);
 
 			DWORD nread;
-			verify("file::read" HERE), ReadFile(m_handle, buffer, size, &nread, NULL);
+			ensure(ReadFile(m_handle, buffer, size, &nread, NULL)); // "file::read"
 
 			return nread;
 		}
@@ -1069,10 +1045,10 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 write(const void* buffer, u64 count) override
 		{
 			// TODO (call WriteFile multiple times if count is too big)
-			const int size = narrow<int>(count, "file::write" HERE);
+			const int size = narrow<int>(count);
 
 			DWORD nwritten;
-			verify("file::write" HERE), WriteFile(m_handle, buffer, size, &nwritten, NULL);
+			ensure(WriteFile(m_handle, buffer, size, &nwritten, NULL)); // "file::write"
 
 			return nwritten;
 		}
@@ -1086,7 +1062,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 				whence == seek_set ? FILE_BEGIN :
 				whence == seek_cur ? FILE_CURRENT :
 				whence == seek_end ? FILE_END :
-				(fmt::throw_exception("Invalid whence (0x%x)" HERE, whence), 0);
+				(fmt::throw_exception("Invalid whence (0x%x)", whence), 0);
 
 			if (!SetFilePointerEx(m_handle, pos, &pos, mode))
 			{
@@ -1100,7 +1076,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 size() override
 		{
 			LARGE_INTEGER size;
-			verify("file::size" HERE), GetFileSizeEx(m_handle, &size);
+			ensure(GetFileSizeEx(m_handle, &size)); // "file::size"
 
 			return size.QuadPart;
 		}
@@ -1149,7 +1125,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 	if (mode & fs::trunc && mode & (fs::lock + fs::unread) && mode & fs::write)
 	{
 		// Postpone truncation in order to avoid using O_TRUNC on a locked file
-		verify(HERE), ::ftruncate(fd, 0) == 0;
+		ensure(::ftruncate(fd, 0) == 0);
 	}
 
 	class unix_file final : public file_base
@@ -1170,7 +1146,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		stat_t stat() override
 		{
 			struct ::stat file_info;
-			verify("file::stat" HERE), ::fstat(m_fd, &file_info) == 0;
+			ensure(::fstat(m_fd, &file_info) == 0); // "file::stat"
 
 			stat_t info;
 			info.is_directory = S_ISDIR(file_info.st_mode);
@@ -1188,7 +1164,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 
 		void sync() override
 		{
-			verify("file::sync" HERE), ::fsync(m_fd) == 0;
+			ensure(::fsync(m_fd) == 0); // "file::sync"
 		}
 
 		bool trunc(u64 length) override
@@ -1205,7 +1181,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 read(void* buffer, u64 count) override
 		{
 			const auto result = ::read(m_fd, buffer, count);
-			verify("file::read" HERE), result != -1;
+			ensure(result != -1); // "file::read"
 
 			return result;
 		}
@@ -1213,7 +1189,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 write(const void* buffer, u64 count) override
 		{
 			const auto result = ::write(m_fd, buffer, count);
-			verify("file::write" HERE), result != -1;
+			ensure(result != -1); // "file::write"
 
 			return result;
 		}
@@ -1224,7 +1200,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 				whence == seek_set ? SEEK_SET :
 				whence == seek_cur ? SEEK_CUR :
 				whence == seek_end ? SEEK_END :
-				(fmt::throw_exception("Invalid whence (0x%x)" HERE, whence), 0);
+				(fmt::throw_exception("Invalid whence (0x%x)", whence), 0);
 
 			const auto result = ::lseek(m_fd, offset, mode);
 
@@ -1240,7 +1216,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 		u64 size() override
 		{
 			struct ::stat file_info;
-			verify("file::size" HERE), ::fstat(m_fd, &file_info) == 0;
+			ensure(::fstat(m_fd, &file_info) == 0); // "file::size"
 
 			return file_info.st_size;
 		}
@@ -1256,7 +1232,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 			static_assert(offsetof(iovec, iov_len) == offsetof(iovec_clone, iov_len), "Weird iovec::iov_len offset");
 
 			const auto result = ::writev(m_fd, reinterpret_cast<const iovec*>(buffers), buf_count);
-			verify("file::write_gather" HERE), result != -1;
+			ensure(result != -1); // "file::write_gather"
 
 			return result;
 		}
@@ -1266,7 +1242,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
 #endif
 }
 
-fs::file::file(const void* ptr, std::size_t size)
+fs::file::file(const void* ptr, usz size)
 {
 	class memory_stream : public file_base
 	{
@@ -1348,11 +1324,6 @@ fs::native_handle fs::file::get_handle() const
 #endif
 }
 
-void fs::dir::xnull() const
-{
-	fmt::throw_exception("fs::dir is null");
-}
-
 bool fs::dir::open(const std::string& path)
 {
 	if (path.empty())
@@ -1386,7 +1357,7 @@ bool fs::dir::open(const std::string& path)
 	class windows_dir final : public dir_base
 	{
 		std::vector<dir_entry> m_entries;
-		std::size_t m_pos = 0;
+		usz m_pos = 0;
 
 		void add_entry(const WIN32_FIND_DATAW& found)
 		{
@@ -1416,7 +1387,7 @@ bool fs::dir::open(const std::string& path)
 				add_entry(found);
 			}
 
-			verify("dir::read" HERE), ERROR_NO_MORE_FILES == GetLastError();
+			ensure(ERROR_NO_MORE_FILES == GetLastError()); // "dir::read"
 			FindClose(handle);
 		}
 
@@ -1632,6 +1603,110 @@ bool fs::remove_all(const std::string& path, bool remove_root)
 	return true;
 }
 
+std::string fs::escape_path(std::string_view path)
+{
+	std::string real; real.resize(path.size());
+
+	auto get_char = [&](usz& from, usz& to, usz count)
+	{
+		std::memcpy(&real[to], &path[from], count);
+		from += count, to += count;
+	};
+
+	usz i = 0, j = -1, pos_nondelim = 0, after_delim = 0;
+
+	if (i < path.size())
+	{
+		j = 0;
+	}
+
+	for (; i < path.size();)
+	{
+		real[j] = path[i];
+#ifdef _Win32
+		if (real[j] == '\\')
+		{
+			real[j] = '/';
+		}
+#endif
+		// If the current character was preceeded by a delimiter special treatment is required:
+		// If another deleimiter is encountered, remove it (do not write it to output string)
+		// Otherwise test if it is a "." or ".." sequence.
+		if (std::exchange(after_delim, path[i] == delim[0] || path[i] == delim[1]))
+		{
+			if (!after_delim)
+			{
+				if (real[j] == '.')
+				{
+					if (i + 1 == path.size())
+					{
+						break;
+					}
+
+					get_char(i, j, 1);
+
+					switch (real[j])
+					{
+					case '.':
+					{
+						bool remove_element = true;
+						usz k = 1;
+
+						for (; k + i != path.size(); k++)
+						{
+							switch (path[i + k])
+							{
+							case '.': continue;
+							case delim[0]: case delim[1]: break;
+							default: remove_element = false; break;
+							}
+						}
+
+						if (remove_element)
+						{
+							if (i == 1u)
+							{
+								j = pos_nondelim;
+								real[j] = '\0';// Ensure termination at this posistion
+								after_delim = true;
+								i += k;
+								continue;
+							}
+						}
+
+						get_char(i, j, k);
+						continue;
+					}
+					case '/':
+					{
+						i++;
+						after_delim = true;
+						continue;
+					}
+					default: get_char(i, j, 1); continue;
+					}
+				}
+
+				pos_nondelim = j;
+				get_char(i, j, 1);
+			}
+			else
+			{
+				i++;
+			}
+		}
+		else
+		{
+			get_char(i, j, 1);
+		}
+	}
+
+	if (j != umax && (real[j] == delim[0] || real[j] == delim[1])) j--; // Do not include a delmiter at the end
+
+	real.resize(j + 1);
+	return real;
+}
+
 u64 fs::get_dir_size(const std::string& path, u64 rounding_alignment)
 {
 	u64 result = 0;
@@ -1640,7 +1715,7 @@ u64 fs::get_dir_size(const std::string& path, u64 rounding_alignment)
 
 	if (!root_dir)
 	{
-		return static_cast<u64>(umax);
+		return -1;
 	}
 
 	for (const auto& entry : root_dir)
@@ -1652,7 +1727,7 @@ u64 fs::get_dir_size(const std::string& path, u64 rounding_alignment)
 
 		if (!entry.is_directory)
 		{
-			result += ::align(entry.size, rounding_alignment);
+			result += utils::align(entry.size, rounding_alignment);
 		}
 		else
 		{
@@ -1818,6 +1893,7 @@ void fmt_class_string<fs::error>::format(std::string& out, u64 arg)
 		case fs::error::readonly: return "Read only";
 		case fs::error::isdir: return "Is a directory";
 		case fs::error::toolong: return "Path too long";
+		case fs::error::nospace: return "Not enough space on the device";
 		case fs::error::unknown: return "Unknown system error";
 		}
 

Utilities/File.h

@@ -1,6 +1,6 @@
-#pragma once
+#pragma once // No BOM and only basic ASCII in this header, or a neko will die
 
-#include "types.h"
+#include "util/types.hpp"
 #include "bit_set.h"
 
 #include <memory>
@@ -8,12 +8,15 @@
 #include <vector>
 #include <algorithm>
 
-
 namespace fs
 {
 #ifdef _WIN32
+	static constexpr auto& delim = "/\\";
+	static constexpr auto& wdelim = L"/\\";
 	using native_handle = void*;
 #else
+	static constexpr auto& delim = "/";
+	static constexpr auto& wdelim = L"/";
 	using native_handle = int;
 #endif
 
@@ -70,7 +73,7 @@ namespace fs
 	struct iovec_clone
 	{
 		const void* iov_base;
-		std::size_t iov_len;
+		usz iov_len;
 	};
 
 	// File handle base
@@ -131,6 +134,12 @@ namespace fs
 		virtual std::unique_ptr<dir_base> open_dir(const std::string& path) = 0;
 	};
 
+	[[noreturn]] void xnull(const src_loc&);
+	[[noreturn]] void xfail(const src_loc&);
+	[[noreturn]] void xovfl();
+
+	constexpr struct pod_tag_t{} pod_tag;
+
 	// Get virtual device for specified path (nullptr for real path)
 	std::shared_ptr<device_base> get_virtual_device(const std::string& path);
 
@@ -183,9 +192,6 @@ namespace fs
 	{
 		std::unique_ptr<file_base> m_file;
 
-		[[noreturn]] void xnull() const;
-		[[noreturn]] void xfail() const;
-
 	public:
 		// Default constructor
 		file() = default;
@@ -194,7 +200,7 @@ namespace fs
 		explicit file(const std::string& path, bs_t<open_mode> mode = ::fs::read);
 
 		// Open memory for read
-		explicit file(const void* ptr, std::size_t size);
+		explicit file(const void* ptr, usz size);
 
 		// Open file with specified args (forward to constructor)
 		template <typename... Args>
@@ -227,144 +233,227 @@ namespace fs
 		}
 
 		// Change file size (possibly appending zero bytes)
-		bool trunc(u64 length) const
+		bool trunc(u64 length,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->trunc(length);
 		}
 
 		// Get file information
-		stat_t stat() const
+		stat_t stat(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->stat();
 		}
 
 		// Sync file buffers
-		void sync() const
+		void sync(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->sync();
 		}
 
 		// Read the data from the file and return the amount of data written in buffer
-		u64 read(void* buffer, u64 count) const
+		u64 read(void* buffer, u64 count,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->read(buffer, count);
 		}
 
 		// Write the data to the file and return the amount of data actually written
-		u64 write(const void* buffer, u64 count) const
+		u64 write(const void* buffer, u64 count,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->write(buffer, count);
 		}
 
 		// Change current position, returns resulting position
-		u64 seek(s64 offset, seek_mode whence = seek_set) const
+		u64 seek(s64 offset, seek_mode whence = seek_set,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->seek(offset, whence);
 		}
 
 		// Get file size
-		u64 size() const
+		u64 size(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->size();
 		}
 
 		// Get current position
-		u64 pos() const
+		u64 pos(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->seek(0, seek_cur);
 		}
 
-		// Write std::string unconditionally
-		const file& write(const std::string& str) const
+		// Write std::basic_string unconditionally
+		template <typename T>
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const std::basic_string<T>& str,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (write(str.data(), str.size()) != str.size()) xfail();
+			if (write(str.data(), str.size() * sizeof(T), line, col, file, func) != str.size() * sizeof(T)) xfail({line, col, file, func});
 			return *this;
 		}
 
 		// Write POD unconditionally
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const T& data) const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const T& data,
+			pod_tag_t = pod_tag,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (write(std::addressof(data), sizeof(T)) != sizeof(T)) xfail();
+			if (write(std::addressof(data), sizeof(T), line, col, file, func) != sizeof(T)) xfail({line, col, file, func});
 			return *this;
 		}
 
 		// Write POD std::vector unconditionally
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const std::vector<T>& vec) const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const std::vector<T>& vec,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (write(vec.data(), vec.size() * sizeof(T)) != vec.size() * sizeof(T)) xfail();
+			if (write(vec.data(), vec.size() * sizeof(T), line, col, file, func) != vec.size() * sizeof(T)) xfail({line, col, file, func});
 			return *this;
 		}
 
-		// Read std::string, size must be set by resize() method
-		bool read(std::string& str) const
+		// Read std::basic_string, size must be set by resize() method
+		template <typename T>
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::basic_string<T>& str,
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION(),
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN()) const
 		{
-			return read(&str[0], str.size()) == str.size();
+			return read(&str[0], str.size() * sizeof(T), line, col, file, func) == str.size() * sizeof(T);
 		}
 
-		// Read std::string
-		bool read(std::string& str, std::size_t size) const
+		// Read std::basic_string
+		template <typename T>
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::basic_string<T>& str, usz size,
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION(),
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN()) const
 		{
 			str.resize(size);
-			return read(&str[0], size) == size;
+			return read(&str[0], size * sizeof(T), line, col, file, func) == size * sizeof(T);
 		}
 
 		// Read POD, sizeof(T) is used
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(T& data) const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(T& data,
+			pod_tag_t = pod_tag,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			return read(&data, sizeof(T)) == sizeof(T);
+			return read(&data, sizeof(T), line, col, file, func) == sizeof(T);
 		}
 
 		// Read POD std::vector, size must be set by resize() method
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec) const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec,
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION(),
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN()) const
 		{
-			return read(vec.data(), sizeof(T) * vec.size()) == sizeof(T) * vec.size();
+			return read(vec.data(), sizeof(T) * vec.size(), line, col, file, func) == sizeof(T) * vec.size();
 		}
 
 		// Read POD std::vector
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec, std::size_t size) const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec, usz size,
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION(),
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN()) const
 		{
 			vec.resize(size);
-			return read(vec.data(), sizeof(T) * size) == sizeof(T) * size;
+			return read(vec.data(), sizeof(T) * size, line, col, file, func) == sizeof(T) * size;
 		}
 
 		// Read POD (experimental)
 		template <typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, T> read() const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, T> read(
+			pod_tag_t = pod_tag,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
 			T result;
-			if (!read(result)) xfail();
+			if (!read(result, pod_tag, line, col, file, func)) xfail({line, col, file, func});
 			return result;
 		}
 
-		// Read full file to std::string
-		std::string to_string() const
+		// Read full file to std::basic_string
+		template <typename T = char>
+		std::basic_string<T> to_string(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			std::string result;
-			result.resize(size());
-			if (seek(0), !read(result)) xfail();
+			std::basic_string<T> result;
+			result.resize(size() / sizeof(T));
+			if (seek(0), !read(result, file, func, line, col)) xfail({line, col, file, func});
 			return result;
 		}
 
 		// Read full file to std::vector
 		template<typename T>
-		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, std::vector<T>> to_vector() const
+		std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, std::vector<T>> to_vector(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
 			std::vector<T> result;
 			result.resize(size() / sizeof(T));
-			if (seek(0), !read(result)) xfail();
+			if (seek(0), !read(result, file, func, line, col)) xfail({line, col, file, func});
 			return result;
 		}
 
@@ -372,9 +461,13 @@ namespace fs
 		native_handle get_handle() const;
 
 		// Gathered write
-		u64 write_gather(const iovec_clone* buffers, u64 buf_count) const
+		u64 write_gather(const iovec_clone* buffers, u64 buf_count,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_file) xnull();
+			if (!m_file) xnull({line, col, file, func});
 			return m_file->write_gather(buffers, buf_count);
 		}
 	};
@@ -383,8 +476,6 @@ namespace fs
 	{
 		std::unique_ptr<dir_base> m_dir;
 
-		[[noreturn]] void xnull() const;
-
 	public:
 		dir() = default;
 
@@ -420,16 +511,24 @@ namespace fs
 		}
 
 		// Get next directory entry
-		bool read(dir_entry& out) const
+		bool read(dir_entry& out,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_dir) xnull();
+			if (!m_dir) xnull({line, col, file, func});
 			return m_dir->read(out);
 		}
 
 		// Reset to the beginning
-		void rewind() const
+		void rewind(
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION()) const
 		{
-			if (!m_dir) xnull();
+			if (!m_dir) xnull({line, col, file, func});
 			return m_dir->rewind();
 		}
 
@@ -498,6 +597,9 @@ namespace fs
 	// Get common cache directory
 	const std::string& get_cache_dir();
 
+	// Get real path for comparisons (TODO: investigate std::filesystem::path::compare implementation)
+	std::string escape_path(std::string_view path);
+
 	// Delete directory and all its contents recursively
 	bool remove_all(const std::string& path, bool remove_root = true);
 
@@ -516,6 +618,7 @@ namespace fs
 		readonly,
 		isdir,
 		toolong,
+		nospace,
 		unknown
 	};
 
@@ -571,7 +674,7 @@ namespace fs
 
 			if (old_size + size < old_size)
 			{
-				fmt::raw_error("fs::container_stream<>::write(): overflow");
+				xovfl();
 			}
 
 			if (pos > old_size)
@@ -627,7 +730,8 @@ namespace fs
 	template <typename... Args>
 	bool write_file(const std::string& path, bs_t<fs::open_mode> mode, const Args&... args)
 	{
-		if (fs::file f{path, mode})
+		// Always use write flag, remove read flag
+		if (fs::file f{path, mode + fs::write - fs::read})
 		{
 			// Write args sequentially
 			(f.write(args), ...);

Utilities/JIT.h

@@ -41,7 +41,7 @@ struct jit_runtime final : asmjit::HostRuntime
 	asmjit::Error _release(void* p) noexcept override;
 
 	// Allocate memory
-	static u8* alloc(std::size_t size, uint align, bool exec = true) noexcept;
+	static u8* alloc(usz size, uint align, bool exec = true) noexcept;
 
 	// Should be called at least once after global initialization
 	static void initialize();
@@ -53,18 +53,77 @@ struct jit_runtime final : asmjit::HostRuntime
 namespace asmjit
 {
 	// Should only be used to build global functions
-	asmjit::JitRuntime& get_global_runtime();
+	asmjit::Runtime& get_global_runtime();
 
-	// Emit xbegin and adjacent loop, return label at xbegin
-	void build_transaction_enter(X86Assembler& c, Label fallback, const X86Gp& ctr, uint less_than);
+	// Emit xbegin and adjacent loop, return label at xbegin (don't use xabort please)
+	template <typename F>
+	[[nodiscard]] inline asmjit::Label build_transaction_enter(asmjit::X86Assembler& c, asmjit::Label fallback, F func)
+	{
+		Label fall = c.newLabel();
+		Label begin = c.newLabel();
+		c.jmp(begin);
+		c.bind(fall);
 
-	// Emit xabort
-	void build_transaction_abort(X86Assembler& c, unsigned char code);
+		// Don't repeat on zero status (may indicate syscall or interrupt)
+		c.test(x86::eax, x86::eax);
+		c.jz(fallback);
+
+		// First invoked after failure (can fallback to proceed, or jump anywhere else)
+		func();
+
+		// Other bad statuses are ignored regardless of repeat flag (TODO)
+		c.align(kAlignCode, 16);
+		c.bind(begin);
+		return fall;
+
+		// xbegin should be issued manually, allows to add more check before entering transaction
+	}
+
+	// Helper to spill RDX (EDX) register for RDTSC
+	inline void build_swap_rdx_with(asmjit::X86Assembler& c, std::array<X86Gp, 4>& args, const asmjit::X86Gp& with)
+	{
+#ifdef _WIN32
+		c.xchg(args[1], with);
+		args[1] = with;
+#else
+		c.xchg(args[2], with);
+		args[2] = with;
+#endif
+	}
+
+	// Get full RDTSC value into chosen register (clobbers rax/rdx or saves only rax with other target)
+	inline void build_get_tsc(asmjit::X86Assembler& c, const asmjit::X86Gp& to = asmjit::x86::rax)
+	{
+		if (&to != &x86::rax && &to != &x86::rdx)
+		{
+			// Swap to save its contents
+			c.xchg(x86::rax, to);
+		}
+
+		c.rdtsc();
+		c.shl(x86::rdx, 32);
+
+		if (&to == &x86::rax)
+		{
+			c.or_(x86::rax, x86::rdx);
+		}
+		else if (&to == &x86::rdx)
+		{
+			c.or_(x86::rdx, x86::rax);
+		}
+		else
+		{
+			// Swap back, maybe there is more effective way to do it
+			c.xchg(x86::rax, to);
+			c.mov(to.r32(), to.r32());
+			c.or_(to.r64(), x86::rdx);
+		}
+	}
 }
 
 // Build runtime function with asmjit::X86Assembler
 template <typename FT, typename F>
-FT build_function_asm(F&& builder)
+inline FT build_function_asm(F&& builder)
 {
 	using namespace asmjit;
 
@@ -89,6 +148,7 @@ FT build_function_asm(F&& builder)
 
 	X86Assembler compiler(&code);
 	builder(std::ref(compiler), args);
+	ensure(compiler.getLastError() == 0);
 
 	FT result;
 
@@ -107,10 +167,9 @@ FT build_function_asm(F&& builder)
 #include <string_view>
 #include <unordered_map>
 
-#include "types.h"
+#include "util/types.hpp"
 #include "mutex.h"
 
-#include "restore_new.h"
 #ifdef _MSC_VER
 #pragma warning(push, 0)
 #else
@@ -127,7 +186,6 @@ FT build_function_asm(F&& builder)
 #else
 #pragma GCC diagnostic pop
 #endif
-#include "define_new_memleakdetect.h"
 
 // Temporary compiler interface
 class jit_compiler final
@@ -135,15 +193,9 @@ class jit_compiler final
 	// Local LLVM context
 	llvm::LLVMContext m_context;
 
-	// JIT Event Listener
-	std::unique_ptr<struct EventListener> m_jit_el;
-
 	// Execution instance
 	std::unique_ptr<llvm::ExecutionEngine> m_engine;
 
-	// Link table
-	std::unordered_map<std::string, u64> m_link;
-
 	// Arch
 	std::string m_cpu;
 
@@ -163,10 +215,10 @@ public:
 	}
 
 	// Add module (path to obj cache dir)
-	void add(std::unique_ptr<llvm::Module> module, const std::string& path);
+	void add(std::unique_ptr<llvm::Module> _module, const std::string& path);
 
 	// Add module (not cached)
-	void add(std::unique_ptr<llvm::Module> module);
+	void add(std::unique_ptr<llvm::Module> _module);
 
 	// Add object (path to obj file)
 	void add(const std::string& path);
@@ -182,12 +234,6 @@ public:
 
 	// Get CPU info
 	static std::string cpu(const std::string& _cpu);
-
-	// Check JIT purpose
-	bool is_primary() const
-	{
-		return !m_link.empty();
-	}
 };
 
 #endif

Utilities/StrFmt.cpp

@@ -1,8 +1,9 @@
-#include "StrFmt.h"
-#include "BEType.h"
+#include "StrFmt.h"
 #include "StrUtil.h"
 #include "cfmt.h"
+#include "util/endian.hpp"
 #include "util/logs.hpp"
+#include "util/v128.hpp"
 
 #include <algorithm>
 #include <string_view>
@@ -78,14 +79,14 @@ void fmt_class_string<fmt::base57>::format(std::string& out, u64 arg)
 		static constexpr u8 s_tail[8] = {0, 2, 3, 5, 6, 7, 9, 10};
 
 		// Get full output size
-		const std::size_t out_size = _arg.size / 8 * 11 + s_tail[_arg.size % 8];
+		const usz out_size = _arg.size / 8 * 11 + s_tail[_arg.size % 8];
 
 		out.resize(out.size() + out_size);
 
 		const auto ptr = &out.front() + (out.size() - out_size);
 
 		// Each 8 bytes of input data produce 11 bytes of base57 output
-		for (std::size_t i = 0, p = 0; i < _arg.size; i += 8, p += 11)
+		for (usz i = 0, p = 0; i < _arg.size; i += 8, p += 11)
 		{
 			// Load up to 8 bytes
 			be_t<u64> be_value;
@@ -235,6 +236,12 @@ void fmt_class_string<bool>::format(std::string& out, u64 arg)
 	out += arg ? "true" : "false";
 }
 
+template <>
+void fmt_class_string<b8>::format(std::string& out, u64 arg)
+{
+	out += get_object(arg) ? "true" : "false";
+}
+
 template <>
 void fmt_class_string<v128>::format(std::string& out, u64 arg)
 {
@@ -242,70 +249,76 @@ void fmt_class_string<v128>::format(std::string& out, u64 arg)
 	fmt::append(out, "0x%016llx%016llx", vec._u64[1], vec._u64[0]);
 }
 
+template <>
+void fmt_class_string<u128>::format(std::string& out, u64 arg)
+{
+	// TODO: it should be supported as full-fledged integral type (with %u, %d, etc, fmt)
+	const u128& num = get_object(arg);
+#ifdef _MSC_VER
+	fmt::append(out, "0x%016llx%016llx", num.hi, num.lo);
+#else
+	fmt::append(out, "0x%016llx%016llx", static_cast<u64>(num >> 64), static_cast<u64>(num));
+#endif
+}
+
+template <>
+void fmt_class_string<src_loc>::format(std::string& out, u64 arg)
+{
+	const src_loc& loc = get_object(arg);
+
+	if (loc.col != umax)
+	{
+		fmt::append(out, "\n(in file %s:%u[:%u]", loc.file, loc.line, loc.col);
+	}
+	else
+	{
+		fmt::append(out, "\n(in file %s:%u", loc.file, loc.line);
+	}
+
+	if (loc.func && *loc.func)
+	{
+		fmt::append(out, ", in function %s)", loc.func);
+	}
+	else
+	{
+		out += ')';
+	}
+
+	// Print error code (may be irrelevant)
+#ifdef _WIN32
+	if (DWORD error = GetLastError())
+	{
+		fmt::append(out, " (e=0x%08x[%u])", error, error);
+	}
+#else
+	if (int error = errno)
+	{
+		fmt::append(out, " (errno=%d)", error);
+	}
+#endif
+}
+
 namespace fmt
 {
-	void raw_error(const char* msg)
-	{
-		thread_ctrl::emergency_exit(msg);
-	}
-
-	void raw_verify_error(const char* msg, const fmt_type_info* sup, u64 arg)
+	[[noreturn]] void raw_verify_error(const src_loc& loc)
 	{
 		std::string out{"Verification failed"};
-
-		// Print error code (may be irrelevant)
-#ifdef _WIN32
-		if (DWORD error = GetLastError())
-		{
-			fmt::append(out, " (e=%#x)", error);
-		}
-#else
-		if (int error = errno)
-		{
-			fmt::append(out, " (e=%d)", error);
-		}
-#endif
-
-		if (sup)
-		{
-			out += " (";
-			sup->fmt_string(out, arg); // Print value
-			out += ")";
-		}
-
-		if (msg)
-		{
-			out += ": ";
-			out += msg;
-		}
-
+		fmt::append(out, "%s", loc);
 		thread_ctrl::emergency_exit(out);
 	}
 
-	void raw_narrow_error(const char* msg, const fmt_type_info* sup, u64 arg)
+	[[noreturn]] void raw_narrow_error(const src_loc& loc)
 	{
-		std::string out{"Narrow error"};
-
-		if (sup)
-		{
-			out += " (";
-			sup->fmt_string(out, arg); // Print value
-			out += ")";
-		}
-
-		if (msg)
-		{
-			out += ": ";
-			out += msg;
-		}
-
+		std::string out{"Narrowing error"};
+		fmt::append(out, "%s", loc);
 		thread_ctrl::emergency_exit(out);
 	}
 
-	void raw_throw_exception(const char* fmt, const fmt_type_info* sup, const u64* args)
+	[[noreturn]] void raw_throw_exception(const src_loc& loc, const char* fmt, const fmt_type_info* sup, const u64* args)
 	{
 		std::string out;
 		raw_append(out, fmt, sup, args);
+		fmt::append(out, "%s", loc);
 		thread_ctrl::emergency_exit(out);
 	}
 
@@ -318,7 +331,7 @@ struct fmt::cfmt_src
 	const fmt_type_info* sup;
 	const u64* args;
 
-	bool test(std::size_t index) const
+	bool test(usz index) const
 	{
 		if (!sup[index].fmt_string)
 		{
@@ -329,26 +342,26 @@ struct fmt::cfmt_src
 	}
 
 	template <typename T>
-	T get(std::size_t index) const
+	T get(usz index) const
 	{
 		return *reinterpret_cast<const T*>(reinterpret_cast<const u8*>(args + index));
 	}
 
-	void skip(std::size_t extra)
+	void skip(usz extra)
 	{
 		sup += extra + 1;
 		args += extra + 1;
 	}
 
-	std::size_t fmt_string(std::string& out, std::size_t extra) const
+	usz fmt_string(std::string& out, usz extra) const
 	{
-		const std::size_t start = out.size();
+		const usz start = out.size();
 		sup[extra].fmt_string(out, args[extra]);
 		return out.size() - start;
 	}
 
 	// Returns type size (0 if unknown, pointer, unsigned, assumed max)
-	std::size_t type(std::size_t extra) const
+	usz type(usz extra) const
 	{
 // Hack: use known function pointers to determine type
 #define TYPE(type) \
@@ -366,14 +379,14 @@ struct fmt::cfmt_src
 		return 0;
 	}
 
-	static constexpr std::size_t size_char  = 1;
-	static constexpr std::size_t size_short = 2;
-	static constexpr std::size_t size_int   = 0;
-	static constexpr std::size_t size_long  = sizeof(ulong);
-	static constexpr std::size_t size_llong = sizeof(ullong);
-	static constexpr std::size_t size_size  = sizeof(std::size_t);
-	static constexpr std::size_t size_max   = sizeof(std::uintmax_t);
-	static constexpr std::size_t size_diff  = sizeof(std::ptrdiff_t);
+	static constexpr usz size_char  = 1;
+	static constexpr usz size_short = 2;
+	static constexpr usz size_int   = 0;
+	static constexpr usz size_long  = sizeof(ulong);
+	static constexpr usz size_llong = sizeof(ullong);
+	static constexpr usz size_size  = sizeof(usz);
+	static constexpr usz size_max   = sizeof(std::uintmax_t);
+	static constexpr usz size_diff  = sizeof(std::ptrdiff_t);
 };
 
 void fmt::raw_append(std::string& out, const char* fmt, const fmt_type_info* sup, const u64* args) noexcept
@@ -409,9 +422,9 @@ std::vector<std::string> fmt::split(const std::string& source, std::initializer_
 {
 	std::vector<std::string> result;
 
-	size_t cursor_begin = 0;
+	usz cursor_begin = 0;
 
-	for (size_t cursor_end = 0; cursor_end < source.length(); ++cursor_end)
+	for (usz cursor_end = 0; cursor_end < source.length(); ++cursor_end)
 	{
 		for (auto& separator : separators)
 		{
@@ -438,7 +451,7 @@ std::vector<std::string> fmt::split(const std::string& source, std::initializer_
 
 std::string fmt::trim(const std::string& source, const std::string& values)
 {
-	std::size_t begin = source.find_first_not_of(values);
+	usz begin = source.find_first_not_of(values);
 
 	if (begin == source.npos)
 		return {};
@@ -464,7 +477,7 @@ std::string fmt::to_lower(const std::string& string)
 
 bool fmt::match(const std::string& source, const std::string& mask)
 {
-	std::size_t source_position = 0, mask_position = 0;
+	usz source_position = 0, mask_position = 0;
 
 	for (; source_position < source.size() && mask_position < mask.size(); ++mask_position, ++source_position)
 	{
@@ -473,7 +486,7 @@ bool fmt::match(const std::string& source, const std::string& mask)
 		case '?': break;
 
 		case '*':
-			for (std::size_t test_source_position = source_position; test_source_position < source.size(); ++test_source_position)
+			for (usz test_source_position = source_position; test_source_position < source.size(); ++test_source_position)
 			{
 				if (match(source.substr(test_source_position), mask.substr(mask_position + 1)))
 				{

Utilities/StrFmt.h

@@ -1,18 +1,16 @@
-#pragma once
+#pragma once // No BOM and only basic ASCII in this header, or a neko will die
 
-#include "types.h"
+#include "util/types.hpp"
 
-#include <exception>
-#include <stdexcept>
 #include <string>
 
 namespace fmt
 {
-	template <typename CharT, std::size_t N, typename... Args>
+	template <typename CharT, usz N, typename... Args>
 	static std::string format(const CharT(&)[N], const Args&...);
 }
 
-template <typename T, typename>
+template <typename T, typename = void>
 struct fmt_unveil
 {
 	static_assert(sizeof(T) > 0, "fmt_unveil<> error: incomplete type");
@@ -21,7 +19,7 @@ struct fmt_unveil
 
 	static inline u64 get(const T& arg)
 	{
-		return reinterpret_cast<std::uintptr_t>(&arg);
+		return reinterpret_cast<uptr>(&arg);
 	}
 
 	// Temporary value container (can possibly be created by other fmt_unveil<> specializations)
@@ -32,7 +30,7 @@ struct fmt_unveil
 		// Allow implicit conversion
 		operator u64() const
 		{
-			return reinterpret_cast<std::uintptr_t>(&arg);
+			return reinterpret_cast<uptr>(&arg);
 		}
 	};
 
@@ -66,17 +64,6 @@ struct fmt_unveil<T, std::enable_if_t<std::is_floating_point<T>::value && sizeof
 	}
 };
 
-template <>
-struct fmt_unveil<f16, void>
-{
-	using type = f16;
-
-	static inline u64 get(const f16& arg)
-	{
-		return fmt_unveil<f64>::get(arg.operator float());
-	}
-};
-
 template <typename T>
 struct fmt_unveil<T, std::enable_if_t<std::is_enum<T>::value>>
 {
@@ -95,29 +82,29 @@ struct fmt_unveil<T*, void>
 
 	static inline u64 get(type arg)
 	{
-		return reinterpret_cast<std::uintptr_t>(arg);
+		return reinterpret_cast<uptr>(arg);
 	}
 };
 
-template <typename T, std::size_t N>
+template <typename T, usz N>
 struct fmt_unveil<T[N], void>
 {
 	using type = std::add_const_t<T>*;
 
 	static inline u64 get(type arg)
 	{
-		return reinterpret_cast<std::uintptr_t>(arg);
+		return reinterpret_cast<uptr>(arg);
 	}
 };
 
-template <>
-struct fmt_unveil<b8, void>
+template <typename T, bool Se, usz Align>
+struct fmt_unveil<se_t<T, Se, Align>, void>
 {
-	using type = bool;
+	using type = typename fmt_unveil<T>::type;
 
-	static inline u64 get(const b8& value)
+	static inline auto get(const se_t<T, Se, Align>& arg)
 	{
-		return fmt_unveil<bool>::get(value);
+		return fmt_unveil<T>::get(arg);
 	}
 };
 
@@ -134,7 +121,7 @@ struct fmt_class_string
 	// Helper function (converts arg to object reference)
 	static SAFE_BUFFERS FORCE_INLINE const T& get_object(u64 arg)
 	{
-		return *reinterpret_cast<const T*>(static_cast<std::uintptr_t>(arg));
+		return *reinterpret_cast<const T*>(static_cast<uptr>(arg));
 	}
 
 	// Enum -> string function type
@@ -236,13 +223,16 @@ struct fmt_type_info
 template <typename... Args>
 using fmt_args_t = const u64(&&)[sizeof...(Args) + 1];
 
+template <typename Arg>
+using fmt_unveil_t = typename fmt_unveil<Arg>::type;
+
 namespace fmt
 {
 	// Base-57 format helper
 	struct base57
 	{
 		const uchar* data;
-		std::size_t size;
+		usz size;
 
 		template <typename T>
 		base57(const T& arg)
@@ -251,7 +241,7 @@ namespace fmt
 		{
 		}
 
-		base57(const uchar* data, std::size_t size)
+		base57(const uchar* data, usz size)
 			: data(data)
 			, size(size)
 		{
@@ -274,7 +264,7 @@ namespace fmt
 	void raw_append(std::string& out, const char*, const fmt_type_info*, const u64*) noexcept;
 
 	// Formatting function
-	template <typename CharT, std::size_t N, typename... Args>
+	template <typename CharT, usz N, typename... Args>
 	SAFE_BUFFERS FORCE_INLINE void append(std::string& out, const CharT(&fmt)[N], const Args&... args)
 	{
 		static constexpr fmt_type_info type_list[sizeof...(Args) + 1]{fmt_type_info::make<fmt_unveil_t<Args>>()...};
@@ -282,7 +272,7 @@ namespace fmt
 	}
 
 	// Formatting function
-	template <typename CharT, std::size_t N, typename... Args>
+	template <typename CharT, usz N, typename... Args>
 	SAFE_BUFFERS FORCE_INLINE std::string format(const CharT(&fmt)[N], const Args&... args)
 	{
 		std::string result;
@@ -291,13 +281,23 @@ namespace fmt
 	}
 
 	// Internal exception message formatting template, must be explicitly specialized or instantiated in cpp to minimize code bloat
-	[[noreturn]] void raw_throw_exception(const char*, const fmt_type_info*, const u64*);
+	[[noreturn]] void raw_throw_exception(const src_loc&, const char*, const fmt_type_info*, const u64*);
 
 	// Throw exception with formatting
-	template <typename... Args>
-	[[noreturn]] SAFE_BUFFERS FORCE_INLINE void throw_exception(const char* fmt, const Args&... args)
+	template <typename CharT, usz N, typename... Args>
+	struct throw_exception
 	{
-		static constexpr fmt_type_info type_list[sizeof...(Args) + 1]{fmt_type_info::make<fmt_unveil_t<Args>>()...};
-		raw_throw_exception(fmt, type_list, fmt_args_t<Args...>{fmt_unveil<Args>::get(args)...});
-	}
+		[[noreturn]] SAFE_BUFFERS FORCE_INLINE throw_exception(const CharT(&fmt)[N], const Args&... args,
+			u32 line = __builtin_LINE(),
+			u32 col = __builtin_COLUMN(),
+			const char* file = __builtin_FILE(),
+			const char* func = __builtin_FUNCTION())
+		{
+			static constexpr fmt_type_info type_list[sizeof...(Args) + 1]{fmt_type_info::make<fmt_unveil_t<Args>>()...};
+			raw_throw_exception({line, col, file, func}, reinterpret_cast<const char*>(fmt), type_list, fmt_args_t<Args...>{fmt_unveil<Args>::get(args)...});
+		}
+	};
+
+	template <typename CharT, usz N, typename... Args>
+	throw_exception(const CharT(&)[N], const Args&...) -> throw_exception<CharT, N, Args...>;
 }

Utilities/StrUtil.h

@@ -17,7 +17,7 @@ std::string utf8_path_to_ansi_path(const std::string& src);
 template <typename D, typename T>
 inline void strcpy_trunc(D& dst, const T& src)
 {
-	const std::size_t count = std::size(src) >= std::size(dst) ? std::size(dst) - 1 : std::size(src);
+	const usz count = std::size(src) >= std::size(dst) ? std::size(dst) - 1 : std::size(src);
 	std::memcpy(std::data(dst), std::data(src), count);
 	std::memset(std::data(dst) + count, 0, std::size(dst) - count);
 }
@@ -27,14 +27,14 @@ namespace fmt
 	std::string replace_first(const std::string& src, const std::string& from, const std::string& to);
 	std::string replace_all(const std::string& src, const std::string& from, const std::string& to);
 
-	template <size_t list_size>
+	template <usz list_size>
 	std::string replace_all(std::string src, const std::pair<std::string, std::string> (&list)[list_size])
 	{
-		for (size_t pos = 0; pos < src.length(); ++pos)
+		for (usz pos = 0; pos < src.length(); ++pos)
 		{
-			for (size_t i = 0; i < list_size; ++i)
+			for (usz i = 0; i < list_size; ++i)
 			{
-				const size_t comp_length = list[i].first.length();
+				const usz comp_length = list[i].first.length();
 
 				if (src.length() - pos < comp_length)
 					continue;
@@ -51,14 +51,14 @@ namespace fmt
 		return src;
 	}
 
-	template <size_t list_size>
+	template <usz list_size>
 	std::string replace_all(std::string src, const std::pair<std::string, std::function<std::string()>> (&list)[list_size])
 	{
-		for (size_t pos = 0; pos < src.length(); ++pos)
+		for (usz pos = 0; pos < src.length(); ++pos)
 		{
-			for (size_t i = 0; i < list_size; ++i)
+			for (usz i = 0; i < list_size; ++i)
 			{
-				const size_t comp_length = list[i].first.length();
+				const usz comp_length = list[i].first.length();
 
 				if (src.length() - pos < comp_length)
 					continue;

Utilities/Thread.h

@@ -1,20 +1,16 @@
 #pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
-#include "util/shared_cptr.hpp"
+#include "util/shared_ptr.hpp"
 
 #include <string>
 #include <memory>
 #include <string_view>
 
 #include "mutex.h"
-#include "cond.h"
 #include "lockless.h"
 
-// Report error and call std::abort(), defined in main.cpp
-[[noreturn]] void report_fatal_error(const std::string&);
-
 // Hardware core layout
 enum class native_core_arrangement : u32
 {
@@ -34,12 +30,15 @@ enum class thread_class : u32
 
 enum class thread_state : u32
 {
-	created,  // Initial state
-	aborting, // The thread has been joined in the destructor or explicitly aborted
-	errored, // Set after the emergency_exit call
-	finished  // Final state, always set at the end of thread execution
+	created = 0,  // Initial state
+	aborting = 1, // The thread has been joined in the destructor or explicitly aborted
+	errored = 2, // Set after the emergency_exit call
+	finished = 3,  // Final state, always set at the end of thread execution
+	mask = 3
 };
 
+class need_wakeup {};
+
 template <class Context>
 class named_thread;
 
@@ -90,6 +89,7 @@ struct thread_thread_name<T, std::void_t<decltype(named_thread<T>::thread_name)>
 // Thread base class
 class thread_base
 {
+public:
 	// Native thread entry point function type
 #ifdef _WIN32
 	using native_entry = uint(__stdcall*)(void* arg);
@@ -97,38 +97,35 @@ class thread_base
 	using native_entry = void*(*)(void* arg);
 #endif
 
+	const native_entry entry_point;
+
+private:
 	// Thread handle (platform-specific)
-	atomic_t<std::uintptr_t> m_thread{0};
+	atomic_t<u64> m_thread{0};
 
-	// Thread playtoy, that shouldn't be used
-	atomic_t<u32> m_signal{0};
-
-	// Thread state
-	atomic_t<thread_state> m_state = thread_state::created;
-
-	// Thread state notification info
-	atomic_t<const void*> m_state_notifier{nullptr};
+	// Thread state and cycles
+	atomic_t<u64> m_sync{0};
 
 	// Thread name
-	stx::atomic_cptr<std::string> m_tname;
-
-	//
-	atomic_t<u64> m_cycles = 0;
+	atomic_ptr<std::string> m_tname;
 
 	// Start thread
-	void start(native_entry);
+	void start();
 
 	// Called at the thread start
-	void initialize(void (*error_cb)(), bool(*wait_cb)(const void*));
+	void initialize(void (*error_cb)());
 
-	// May be called in destructor
-	void notify_abort() noexcept;
-
-	// Called at the thread end, returns true if needs destruction
-	bool finalize(thread_state result) noexcept;
+	// Called at the thread end, returns self handle
+	u64 finalize(thread_state result) noexcept;
 
 	// Cleanup after possibly deleting the thread instance
-	static void finalize() noexcept;
+	static native_entry finalize(u64 _self) noexcept;
+
+	// Set name for debugger
+	static void set_name(std::string);
+
+	// Make entry point
+	static native_entry make_trampoline(u64(*)(thread_base*));
 
 	friend class thread_ctrl;
 
@@ -136,7 +133,7 @@ class thread_base
 	friend class named_thread;
 
 protected:
-	thread_base(std::string_view name);
+	thread_base(native_entry, std::string_view name);
 
 	~thread_base();
 
@@ -145,10 +142,13 @@ public:
 	u64 get_cycles();
 
 	// Wait for the thread (it does NOT change thread state, and can be called from multiple threads)
-	bool join() const;
+	bool join(bool dtor = false) const;
 
 	// Notify the thread
 	void notify();
+
+	// Get thread id
+	u64 get_native_id() const;
 };
 
 // Collection of global function for current thread
@@ -188,14 +188,14 @@ public:
 	// Set current thread name (not recommended)
 	static void set_name(std::string_view name)
 	{
-		g_tls_this_thread->m_tname.store(stx::shared_cptr<std::string>::make(name));
+		g_tls_this_thread->m_tname.store(make_single<std::string>(name));
 	}
 
 	// Set thread name (not recommended)
 	template <typename T>
 	static void set_name(named_thread<T>& thread, std::string_view name)
 	{
-		static_cast<thread_base&>(thread).m_tname.store(stx::shared_cptr<std::string>::make(name));
+		static_cast<thread_base&>(thread).m_tname.store(make_single<std::string>(name));
 	}
 
 	template <typename T>
@@ -210,10 +210,16 @@ public:
 		static_cast<thread_base&>(thread).notify();
 	}
 
+	template <typename T>
+	static u64 get_native_id(named_thread<T>& thread)
+	{
+		return static_cast<thread_base&>(thread).get_native_id();
+	}
+
 	// Read current state
 	static inline thread_state state()
 	{
-		return g_tls_this_thread->m_state;
+		return static_cast<thread_state>(g_tls_this_thread->m_sync & 3);
 	}
 
 	// Wait once with timeout. May spuriously return false.
@@ -249,8 +255,18 @@ public:
 	// Sets the preferred affinity mask for this thread
 	static void set_thread_affinity_mask(u64 mask);
 
+	// Get process affinity mask
+	static u64 get_process_affinity_mask();
+
 	// Miscellaneous
 	static u64 get_thread_affinity_mask();
+
+	// Get current thread stack addr and size
+	static std::pair<void*, usz> get_thread_stack();
+
+private:
+	// Miscellaneous
+	static const u64 process_affinity_mask;
 };
 
 // Derived from the callable object Context, possibly a lambda
@@ -260,59 +276,20 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
 	using result = result_storage_t<Context>;
 	using thread = thread_base;
 
-	// Type-erased thread entry point
-#ifdef _WIN32
-	static inline uint __stdcall entry_point(void* arg)
-#else
-	static inline void* entry_point(void* arg)
-#endif
+	static u64 entry_point(thread_base* _base)
 	{
-		const auto _this = static_cast<named_thread*>(static_cast<thread*>(arg));
-
-		// Perform self-cleanup if necessary
-		if (_this->entry_point())
-		{
-			delete _this;
-		}
-
-		thread::finalize();
-		return 0;
+		return static_cast<named_thread*>(_base)->entry_point2();
 	}
 
-	bool entry_point()
+	u64 entry_point2()
 	{
-		auto tls_error_cb = []()
+		thread::initialize([]()
 		{
 			if constexpr (!result::empty)
 			{
 				// Construct using default constructor in the case of failure
 				new (static_cast<result*>(static_cast<named_thread*>(thread_ctrl::get_current()))->get()) typename result::type();
 			}
-		};
-
-		thread::initialize(tls_error_cb, [](const void* data)
-		{
-			const auto _this = thread_ctrl::get_current();
-
-			if (_this->m_state >= thread_state::aborting)
-			{
-				return false;
-			}
-
-			_this->m_state_notifier.release(data);
-
-			if (!data)
-			{
-				return true;
-			}
-
-			if (_this->m_state >= thread_state::aborting)
-			{
-				_this->m_state_notifier.release(nullptr);
-				return false;
-			}
-
-			return true;
 		});
 
 		if constexpr (result::empty)
@@ -329,6 +306,8 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
 		return thread::finalize(thread_state::finished);
 	}
 
+	static inline thread::native_entry trampoline = thread::make_trampoline(entry_point);
+
 	friend class thread_ctrl;
 
 public:
@@ -336,26 +315,26 @@ public:
 	template <bool Valid = std::is_default_constructible_v<Context> && thread_thread_name<Context>(), typename = std::enable_if_t<Valid>>
 	named_thread()
 		: Context()
-		, thread(Context::thread_name)
+		, thread(trampoline, Context::thread_name)
 	{
-		thread::start(&named_thread::entry_point);
+		thread::start();
 	}
 
 	// Normal forwarding constructor
 	template <typename... Args, typename = std::enable_if_t<std::is_constructible_v<Context, Args&&...>>>
 	named_thread(std::string_view name, Args&&... args)
 		: Context(std::forward<Args>(args)...)
-		, thread(name)
+		, thread(trampoline, name)
 	{
-		thread::start(&named_thread::entry_point);
+		thread::start();
 	}
 
 	// Lambda constructor, also the implicit deduction guide candidate
 	named_thread(std::string_view name, Context&& f)
 		: Context(std::forward<Context>(f))
-		, thread(name)
+		, thread(trampoline, name)
 	{
-		thread::start(&named_thread::entry_point);
+		thread::start();
 	}
 
 	named_thread(const named_thread&) = delete;
@@ -387,19 +366,22 @@ public:
 	// Access thread state
 	operator thread_state() const
 	{
-		return thread::m_state.load();
+		return static_cast<thread_state>(thread::m_sync.load() & 3);
 	}
 
 	// Try to abort by assigning thread_state::aborting (UB if assigning different state)
 	named_thread& operator=(thread_state s)
 	{
-		ASSUME(s == thread_state::aborting);
-
-		if (s == thread_state::aborting && thread::m_state.compare_and_swap_test(thread_state::created, s))
+		if (s == thread_state::aborting && thread::m_sync.fetch_op([](u64& v){ return !(v & 3) && (v |= 1); }).second)
 		{
 			if (s == thread_state::aborting)
 			{
-				thread::notify_abort();
+				thread::m_sync.notify_one(1);
+			}
+
+			if constexpr (std::is_base_of_v<need_wakeup, Context>)
+			{
+				this->wake_up();
 			}
 		}
 
@@ -411,7 +393,7 @@ public:
 	{
 		// Assign aborting state forcefully
 		operator=(thread_state::aborting);
-		thread::join();
+		thread::join(true);
 
 		if constexpr (!result::empty)
 		{

Utilities/Timer.h

@@ -1,6 +1,6 @@
 #pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 
 #include <chrono>
 
@@ -8,8 +8,8 @@ class Timer
 {
 private:
 	bool m_stopped;
-	std::chrono::steady_clock::time_point m_start;
-	std::chrono::steady_clock::time_point m_end;
+	steady_clock::time_point m_start;
+	steady_clock::time_point m_end;
 
 public:
 	Timer() : m_stopped(false)
@@ -19,13 +19,13 @@ public:
 	void Start()
 	{
 		m_stopped = false;
-		m_start = std::chrono::steady_clock::now();
+		m_start = steady_clock::now();
 	}
 
 	void Stop()
 	{
 		m_stopped = true;
-		m_end = std::chrono::steady_clock::now();
+		m_end = steady_clock::now();
 	}
 
 	double GetElapsedTimeInSec() const
@@ -40,21 +40,21 @@ public:
 
 	u64 GetElapsedTimeInMicroSec() const
 	{
-		std::chrono::steady_clock::time_point now = m_stopped ? m_end : std::chrono::steady_clock::now();
+		steady_clock::time_point now = m_stopped ? m_end : steady_clock::now();
 
 		return std::chrono::duration_cast<std::chrono::microseconds>(now - m_start).count();
 	}
 
 	u64 GetElapsedTimeInNanoSec() const
 	{
-		std::chrono::steady_clock::time_point now = m_stopped ? m_end : std::chrono::steady_clock::now();
+		steady_clock::time_point now = m_stopped ? m_end : steady_clock::now();
 
 		return std::chrono::duration_cast<std::chrono::nanoseconds>(now - m_start).count();
 	}
 
-	u64 GetMsSince(std::chrono::steady_clock::time_point timestamp)
+	u64 GetMsSince(steady_clock::time_point timestamp)
 	{
-		std::chrono::steady_clock::time_point now = m_stopped ? m_end : std::chrono::steady_clock::now();
+		steady_clock::time_point now = m_stopped ? m_end : steady_clock::now();
 
 		return std::chrono::duration_cast<std::chrono::milliseconds>(now - timestamp).count();
 	}

Utilities/address_range.h

@@ -1,6 +1,6 @@
-#pragma once
+#pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include "StrFmt.h"
 #include <vector>
 
@@ -92,7 +92,7 @@ namespace utils
 		void set_length(const u32 new_length)
 		{
 			end = start + new_length - 1;
-			ASSERT(valid());
+			ensure(valid());
 		}
 
 		u32 next_address() const
@@ -282,7 +282,7 @@ namespace utils
 
 	public:
 		// Wrapped functions
-		inline void reserve(size_t nr) { data.reserve(nr); }
+		inline void reserve(usz nr) { data.reserve(nr); }
 		inline void clear() { data.clear(); }
 		inline size_type size() const { return data.size(); }
 		inline bool empty() const { return data.empty(); }
@@ -456,9 +456,9 @@ namespace utils
 		// Will fail if ranges within the vector overlap our touch each-other
 		bool check_consistency() const
 		{
-			size_t _size = data.size();
+			usz _size = data.size();
 
-			for (size_t i = 0; i < _size; ++i)
+			for (usz i = 0; i < _size; ++i)
 			{
 				const auto &r1 = data[i];
 				if (!r1.valid())
@@ -466,7 +466,7 @@ namespace utils
 					continue;
 				}
 
-				for (size_t j = i + 1; j < _size; ++j)
+				for (usz j = i + 1; j < _size; ++j)
 				{
 					const auto &r2 = data[j];
 					if (!r2.valid())
@@ -582,15 +582,15 @@ namespace utils
 
 namespace std
 {
-	static_assert(sizeof(size_t) >= 2 * sizeof(u32), "size_t must be at least twice the size of u32");
+	static_assert(sizeof(usz) >= 2 * sizeof(u32), "usz must be at least twice the size of u32");
 
 	template <>
 	struct hash<utils::address_range>
 	{
-		std::size_t operator()(const utils::address_range& k) const
+		usz operator()(const utils::address_range& k) const
 		{
-			// we can guarantee a unique hash since our type is 64 bits and size_t as well
-			return (size_t{ k.start } << 32) | size_t{ k.end };
+			// we can guarantee a unique hash since our type is 64 bits and usz as well
+			return (usz{ k.start } << 32) | usz{ k.end };
 		}
 	};
 }

Utilities/asm.h

@@ -1,215 +0,0 @@
-#pragma once
-
-#include "types.h"
-
-namespace utils
-{
-// Rotate helpers
-#if defined(__GNUG__)
-
-	inline u8 rol8(u8 x, u8 n)
-	{
-#if __has_builtin(__builtin_rotateleft8)
-		return __builtin_rotateleft8(x, n);
-#else
-		u8 result = x;
-		__asm__("rolb %[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u8 ror8(u8 x, u8 n)
-	{
-#if __has_builtin(__builtin_rotateright8)
-		return __builtin_rotateright8(x, n);
-#else
-		u8 result = x;
-		__asm__("rorb %[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u16 rol16(u16 x, u16 n)
-	{
-#if __has_builtin(__builtin_rotateleft16)
-		return __builtin_rotateleft16(x, n);
-#else
-		u16 result = x;
-		__asm__("rolw %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u16 ror16(u16 x, u16 n)
-	{
-#if __has_builtin(__builtin_rotateright16)
-		return __builtin_rotateright16(x, n);
-#else
-		u16 result = x;
-		__asm__("rorw %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u32 rol32(u32 x, u32 n)
-	{
-#if __has_builtin(__builtin_rotateleft32)
-		return __builtin_rotateleft32(x, n);
-#else
-		u32 result = x;
-		__asm__("roll %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u32 ror32(u32 x, u32 n)
-	{
-#if __has_builtin(__builtin_rotateright32)
-		return __builtin_rotateright32(x, n);
-#else
-		u32 result = x;
-		__asm__("rorl %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u64 rol64(u64 x, u64 n)
-	{
-#if __has_builtin(__builtin_rotateleft64)
-		return __builtin_rotateleft64(x, n);
-#else
-		u64 result = x;
-		__asm__("rolq %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	inline u64 ror64(u64 x, u64 n)
-	{
-#if __has_builtin(__builtin_rotateright64)
-		return __builtin_rotateright64(x, n);
-#else
-		u64 result = x;
-		__asm__("rorq %b[n], %[result]" : [result] "+g"(result) : [n] "c"(n));
-		return result;
-#endif
-	}
-
-	constexpr u64 umulh64(u64 a, u64 b)
-	{
-		const __uint128_t x = a;
-		const __uint128_t y = b;
-		return (x * y) >> 64;
-	}
-
-	constexpr s64 mulh64(s64 a, s64 b)
-	{
-		const __int128_t x = a;
-		const __int128_t y = b;
-		return (x * y) >> 64;
-	}
-
-	constexpr s64 div128(s64 high, s64 low, s64 divisor, s64* remainder = nullptr)
-	{
-		const __int128_t x = (__uint128_t{u64(high)} << 64) | u64(low);
-		const __int128_t r = x / divisor;
-
-		if (remainder)
-		{
-			*remainder = x % divisor;
-		}
-
-		return r;
-	}
-
-	constexpr u64 udiv128(u64 high, u64 low, u64 divisor, u64* remainder = nullptr)
-	{
-		const __uint128_t x = (__uint128_t{high} << 64) | low;
-		const __uint128_t r = x / divisor;
-
-		if (remainder)
-		{
-			*remainder = x % divisor;
-		}
-
-		return r;
-	}
-
-#elif defined(_MSC_VER)
-	inline u8 rol8(u8 x, u8 n)
-	{
-		return _rotl8(x, n);
-	}
-
-	inline u8 ror8(u8 x, u8 n)
-	{
-		return _rotr8(x, n);
-	}
-
-	inline u16 rol16(u16 x, u16 n)
-	{
-		return _rotl16(x, (u8)n);
-	}
-
-	inline u16 ror16(u16 x, u16 n)
-	{
-		return _rotr16(x, (u8)n);
-	}
-
-	inline u32 rol32(u32 x, u32 n)
-	{
-		return _rotl(x, (int)n);
-	}
-
-	inline u32 ror32(u32 x, u32 n)
-	{
-		return _rotr(x, (int)n);
-	}
-
-	inline u64 rol64(u64 x, u64 n)
-	{
-		return _rotl64(x, (int)n);
-	}
-
-	inline u64 ror64(u64 x, u64 n)
-	{
-		return _rotr64(x, (int)n);
-	}
-
-	inline u64 umulh64(u64 x, u64 y)
-	{
-		return __umulh(x, y);
-	}
-
-	inline s64 mulh64(s64 x, s64 y)
-	{
-		return __mulh(x, y);
-	}
-
-	inline s64 div128(s64 high, s64 low, s64 divisor, s64* remainder = nullptr)
-	{
-		s64 rem;
-		s64 r = _div128(high, low, divisor, &rem);
-
-		if (remainder)
-		{
-			*remainder = rem;
-		}
-
-		return r;
-	}
-
-	inline u64 udiv128(u64 high, u64 low, u64 divisor, u64* remainder = nullptr)
-	{
-		u64 rem;
-		u64 r = _udiv128(high, low, divisor, &rem);
-
-		if (remainder)
-		{
-			*remainder = rem;
-		}
-
-		return r;
-	}
-#endif
-} // namespace utils

Utilities/bin_patch.h

@@ -1,12 +1,30 @@
 #pragma once
 
-#include "BEType.h"
 #include <vector>
 #include <string>
 #include <unordered_map>
 
+#include "util/types.hpp"
+#include "util/yaml.hpp"
+
+namespace patch_key
+{
+	static const std::string all = "All";
+	static const std::string anchors = "Anchors";
+	static const std::string author = "Author";
+	static const std::string games = "Games";
+	static const std::string group = "Group";
+	static const std::string notes = "Notes";
+	static const std::string patch = "Patch";
+	static const std::string patch_version = "Patch Version";
+	static const std::string version = "Version";
+}
+
+static const std::string patch_engine_version = "1.2";
+
 enum class patch_type
 {
+	invalid,
 	load,
 	byte,
 	le16,
@@ -23,22 +41,110 @@ enum class patch_type
 
 class patch_engine
 {
-	struct patch
+public:
+	struct patch_data
 	{
-		patch_type type;
-		u32 offset;
-		u64 value;
+		patch_type type = patch_type::load;
+		u32 offset = 0;
+		std::string original_value; // Used for import consistency (avoid rounding etc.)
+		union
+		{
+			u64 long_value;
+			f64 double_value;
+		} value { 0 };
 	};
 
-	// Database
-	std::unordered_map<std::string, std::vector<patch>> m_map;
+	using patch_app_versions = std::unordered_map<std::string /*app_version*/, bool /*enabled*/>;
+	using patch_serials = std::unordered_map<std::string /*serial*/, patch_app_versions>;
+	using patch_titles = std::unordered_map<std::string /*serial*/, patch_serials>;
 
-public:
-	// Load from file
-	void append(const std::string& path);
+	struct patch_info
+	{
+		// Patch information
+		std::vector<patch_data> data_list;
+		patch_titles titles;
+		std::string description;
+		std::string patch_version;
+		std::string patch_group;
+		std::string author;
+		std::string notes;
+		std::string source_path;
+
+		// Redundant information for accessibility (see patch_container)
+		std::string hash;
+		std::string version;
+		bool is_legacy = false;
+		bool is_enabled = false; // only for legacy patches
+	};
+
+	struct patch_container
+	{
+		std::unordered_map<std::string /*description*/, patch_info> patch_info_map;
+		std::string hash;
+		std::string version;
+		bool is_legacy = false;
+	};
+
+	using patch_map = std::unordered_map<std::string /*hash*/, patch_container>;
+
+	patch_engine();
+
+	// Returns the directory in which patch_config.yml is located
+	static std::string get_patch_config_path();
+
+	// Returns the directory in which patches are located
+	static std::string get_patches_path();
+
+	// Returns the filepath for the imported_patch.yml
+	static std::string get_imported_patch_path();
+
+	// Load from file and append to specified patches map
+	static bool load(patch_map& patches, const std::string& path, std::string content = "", bool importing = false, std::stringstream* log_messages = nullptr);
+
+	// Read and add a patch node to the patch info
+	static bool read_patch_node(patch_info& info, YAML::Node node, const YAML::Node& root, std::stringstream* log_messages = nullptr);
+
+	// Get the patch type of a patch node
+	static patch_type get_patch_type(YAML::Node node);
+
+	// Add the data of a patch node
+	static bool add_patch_data(YAML::Node node, patch_info& info, u32 modifier, const YAML::Node& root, std::stringstream* log_messages = nullptr);
+
+	// Save to patch_config.yml
+	static void save_config(const patch_map& patches_map, bool enable_legacy_patches);
+
+	// Save a patch file
+	static bool save_patches(const patch_map& patches, const std::string& path, std::stringstream* log_messages = nullptr);
+
+	// Create or append patches to a file
+	static bool import_patches(const patch_map& patches, const std::string& path, usz& count, usz& total, std::stringstream* log_messages = nullptr);
+
+	// Remove a patch from a file
+	static bool remove_patch(const patch_info& info);
+
+	// Load patch_config.yml
+	static patch_map load_config(bool& enable_legacy_patches);
+
+	// Load from file and append to member patches map
+	void append_global_patches();
+
+	// Load from title relevant files and append to member patches map
+	void append_title_patches(const std::string& title_id);
 
 	// Apply patch (returns the number of entries applied)
-	std::size_t apply(const std::string& name, u8* dst) const;
+	usz apply(const std::string& name, u8* dst);
+
 	// Apply patch with a check that the address exists in SPU local storage
-	std::size_t apply_with_ls_check(const std::string&name, u8*dst, u32 filesz, u32 ls_addr) const;
+	usz apply_with_ls_check(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
+
+private:
+	// Internal: Apply patch (returns the number of entries applied)
+	template <bool check_local_storage>
+	usz apply_patch(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
+
+	// Database
+	patch_map m_map;
+
+	// Only one patch per patch group can be applied
+	std::set<std::string> m_applied_groups;
 };

Utilities/bit_set.h

@@ -21,8 +21,9 @@ Examples:
 Intersection (&) and symmetric difference (^) is also available.
 */
 
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
+#include "Utilities/StrFmt.h"
 
 template <typename T>
 class atomic_bs_t;
@@ -48,8 +49,8 @@ private:
 	}
 
 public:
-	static constexpr std::size_t bitmax = sizeof(T) * 8;
-	static constexpr std::size_t bitsize = static_cast<under>(T::__bitset_enum_max);
+	static constexpr usz bitmax = sizeof(T) * 8;
+	static constexpr usz bitsize = static_cast<under>(T::__bitset_enum_max);
 
 	static_assert(std::is_enum<T>::value, "bs_t<> error: invalid type (must be enum)");
 	static_assert(bitsize <= bitmax, "bs_t<> error: invalid __bitset_enum_max");
@@ -205,7 +206,7 @@ constexpr bs_t<T> operator ^(T lhs, T rhs)
 
 // Atomic bitset specialization with optimized operations
 template <typename T>
-class atomic_bs_t : public atomic_t<::bs_t<T>> // TODO: true specialization
+class atomic_bs_t : public atomic_t<::bs_t<T>>
 {
 	// Corresponding bitset type
 	using bs_t = ::bs_t<T>;
@@ -379,11 +380,6 @@ public:
 		return lhs.m_data != rhs.load().m_data;
 	}
 
-	bool test(const bs_t& rhs)
-	{
-		return base::load().test(rhs);
-	}
-
 	bool test_and_set(T rhs)
 	{
 		return atomic_storage<under>::bts(m_data.m_data, static_cast<uint>(static_cast<under>(rhs)));
@@ -394,10 +390,14 @@ public:
 		return atomic_storage<under>::btr(m_data.m_data, static_cast<uint>(static_cast<under>(rhs)));
 	}
 
-	bool test_and_complement(T rhs)
+	bool test_and_invert(T rhs)
 	{
 		return atomic_storage<under>::btc(m_data.m_data, static_cast<uint>(static_cast<under>(rhs)));
 	}
+
+	bool bit_test_set(uint bit) = delete;
+	bool bit_test_reset(uint bit) = delete;
+	bool bit_test_invert(uint bit) = delete;
 };
 
 template <typename T>

Utilities/cfmt.h

@@ -1,12 +1,12 @@
 #pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include <climits>
 #include <string>
 #include <vector>
 #include <algorithm>
 
-static const size_t size_dropped = std::numeric_limits<size_t>::max();
+static const usz size_dropped = -1;
 
 /*
 C-style format parser. Appends formatted string to `out`, returns number of characters written.
@@ -15,13 +15,13 @@ C-style format parser. Appends formatted string to `out`, returns number of char
 `src`: rvalue reference to argument provider.
 */
 template<typename Dst, typename Char, typename Src>
-std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
+usz cfmt_append(Dst& out, const Char* fmt, Src&& src)
 {
-	const std::size_t start_pos = out.size();
+	const usz start_pos = out.size();
 
 	struct cfmt_context
 	{
-		std::size_t size; // Size of current format sequence
+		usz size; // Size of current format sequence
 
 		u8 args; // Number of extra args used
 		u8 type; // Integral type bytesize
@@ -80,7 +80,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 
 	const auto write_decimal = [&](u64 value, s64 min_size)
 	{
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		do
 		{
@@ -90,7 +90,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		while (0 < --min_size || value);
 
 		// Revert written characters
-		for (std::size_t i = start, j = out.size() - 1; i < j; i++, j--)
+		for (usz i = start, j = out.size() - 1; i < j; i++, j--)
 		{
 			std::swap(out[i], out[j]);
 		}
@@ -285,7 +285,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			break;
 		}
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 		out.push_back(src.template get<Char>(ctx.args));
 
 		if (1 < ctx.width)
@@ -307,8 +307,8 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			break;
 		}
 
-		const std::size_t start = out.size();
-		const std::size_t size1 = src.fmt_string(out, ctx.args);
+		const usz start = out.size();
+		const usz size1 = src.fmt_string(out, ctx.args);
 
 		if (ctx.dot && size1 > ctx.prec)
 		{
@@ -316,7 +316,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			out.resize(start + ctx.prec);
 		}
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -352,7 +352,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		const u64 val = src.template get<u64>(ctx.args);
 		const bool negative = ctx.type && static_cast<s64>(val) < 0;
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		if (!ctx.dot || ctx.prec)
 		{
@@ -372,7 +372,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			write_decimal(negative ? 0 - val : val, ctx.prec);
 		}
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -419,7 +419,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		// Trunc sign-extended signed types
 		const u64 val = src.template get<u64>(ctx.args) & mask;
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		if (ctx.alter)
 		{
@@ -435,7 +435,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			write_octal(val, ctx.prec);
 		}
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -476,7 +476,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		// Trunc sign-extended signed types
 		const u64 val = src.template get<u64>(ctx.args) & mask;
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		if (ctx.alter)
 		{
@@ -493,7 +493,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 			write_hex(val, ch == 'X', ctx.prec);
 		}
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -540,14 +540,14 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		// Trunc sign-extended signed types
 		const u64 val = src.template get<u64>(ctx.args) & mask;
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		if (!ctx.dot || ctx.prec)
 		{
 			write_decimal(val, ctx.prec);
 		}
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -570,11 +570,11 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 
 		const u64 val = src.template get<u64>(ctx.args);
 
-		const std::size_t start = out.size();
+		const usz start = out.size();
 
 		write_hex(val, false, sizeof(void*) * 2);
 
-		const std::size_t size2 = out.size() - start;
+		const usz size2 = out.size() - start;
 
 		if (size2 < ctx.width)
 		{
@@ -610,7 +610,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
 		const u64 arg1 = ctx.args >= 1 ? src.template get<u64>(1) : 0;
 		const u64 arg2 = ctx.args >= 2 ? src.template get<u64>(2) : 0;
 
-		if (const std::size_t _size = std::snprintf(0, 0, _fmt.c_str(), arg0, arg1, arg2))
+		if (const usz _size = std::snprintf(0, 0, _fmt.c_str(), arg0, arg1, arg2))
 		{
 			out.resize(out.size() + _size);
 			std::snprintf(&out.front() + out.size() - _size, _size + 1, _fmt.c_str(), arg0, arg1, arg2);

Utilities/cheat_info.cpp

@@ -0,0 +1,32 @@
+#include "stdafx.h"
+#include "cheat_info.h"
+#include "Config.h"
+#include "StrUtil.h"
+
+LOG_CHANNEL(log_cheat, "Cheat");
+
+bool cheat_info::from_str(const std::string& cheat_line)
+{
+	auto cheat_vec = fmt::split(cheat_line, {"@@@"}, false);
+
+	s64 val64 = 0;
+	if (cheat_vec.size() != 5 || !cfg::try_to_int64(&val64, cheat_vec[2], 0, cheat_type_max - 1))
+	{
+		log_cheat.fatal("Failed to parse cheat line");
+		return false;
+	}
+
+	game        = cheat_vec[0];
+	description = cheat_vec[1];
+	type        = cheat_type{::narrow<u8>(val64)};
+	offset      = std::stoul(cheat_vec[3]);
+	red_script  = cheat_vec[4];
+
+	return true;
+}
+
+std::string cheat_info::to_str() const
+{
+	std::string cheat_str = game + "@@@" + description + "@@@" + std::to_string(static_cast<u8>(type)) + "@@@" + std::to_string(offset) + "@@@" + red_script + "@@@";
+	return cheat_str;
+}

Utilities/cheat_info.h

@@ -0,0 +1,32 @@
+#pragma once
+
+#include "util/types.hpp"
+
+#include <string>
+
+enum class cheat_type : u8
+{
+	unsigned_8_cheat,
+	unsigned_16_cheat,
+	unsigned_32_cheat,
+	unsigned_64_cheat,
+	signed_8_cheat,
+	signed_16_cheat,
+	signed_32_cheat,
+	signed_64_cheat,
+	max
+};
+
+constexpr u8 cheat_type_max = static_cast<u8>(cheat_type::max);
+
+struct cheat_info
+{
+	std::string game;
+	std::string description;
+	cheat_type type = cheat_type::max;
+	u32 offset{};
+	std::string red_script;
+
+	bool from_str(const std::string& cheat_line);
+	std::string to_str() const;
+};

Utilities/cond.cpp

@@ -1,4 +1,4 @@
-#include "cond.h"
+#include "cond.h"
 #include "sync.h"
 #include "lockless.h"
 
@@ -9,10 +9,10 @@
 void cond_variable::imp_wait(u32 _old, u64 _timeout) noexcept
 {
 	// Not supposed to fail
-	verify(HERE), _old;
+	ensure(_old);
 
 	// Wait with timeout
-	m_value.wait<c_signal_mask>(_old, atomic_wait_timeout{_timeout > max_timeout ? UINT64_MAX : _timeout * 1000});
+	m_value.wait(_old, c_signal_mask, atomic_wait_timeout{_timeout > max_timeout ? UINT64_MAX : _timeout * 1000});
 
 	// Cleanup
 	m_value.atomic_op([](u32& value)
@@ -50,10 +50,10 @@ void cond_variable::imp_wake(u32 _count) noexcept
 	if (_count > 1 || ((_old + (c_signal_mask & (0 - c_signal_mask))) & c_signal_mask) == c_signal_mask)
 	{
 		// Resort to notify_all if signal count reached max
-		m_value.notify_all();
+		m_value.notify_all(c_signal_mask);
 	}
 	else
 	{
-		m_value.notify_one();
+		m_value.notify_one(c_signal_mask);
 	}
 }

Utilities/cond.h

@@ -1,8 +1,7 @@
 #pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
-#include <shared_mutex>
 
 // Lightweight condition variable
 class cond_variable

Utilities/geometry.h

@@ -1,4 +1,4 @@
-#pragma once
+#pragma once
 
 #include <cmath>
 

Utilities/hash.h

@@ -1,23 +1,23 @@
 #pragma once
 
-#include "Utilities/types.h"
+#include "util/types.hpp"
 
 namespace rpcs3
 {
 	template<typename T>
-	static size_t hash_base(T value)
+	static usz hash_base(T value)
 	{
-		return static_cast<size_t>(value);
+		return static_cast<usz>(value);
 	}
 
 	template<typename T, typename U>
-	static size_t hash_struct_base(const T& value)
+	static usz hash_struct_base(const T& value)
 	{
 		// FNV 64-bit
-		size_t result = 14695981039346656037ull;
+		usz result = 14695981039346656037ull;
 		const U *bits = reinterpret_cast<const U*>(&value);
 
-		for (size_t n = 0; n < (sizeof(T) / sizeof(U)); ++n)
+		for (usz n = 0; n < (sizeof(T) / sizeof(U)); ++n)
 		{
 			result ^= bits[n];
 			result *= 1099511628211ull;
@@ -27,7 +27,7 @@ namespace rpcs3
 	}
 
 	template<typename T>
-	static size_t hash_struct(const T& value)
+	static usz hash_struct(const T& value)
 	{
 		static constexpr auto block_sz = sizeof(T);
 

Utilities/lockless.h

@@ -1,6 +1,6 @@
-#pragma once
+#pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
 
 //! Simple sizeless array base for concurrent access. Cannot shrink, only growths automatically.
@@ -8,7 +8,7 @@
 //!
 //! T is the type of elements. Currently, default constructor of T shall be constexpr.
 //! N is initial element count, available without any memory allocation and only stored contiguously.
-template <typename T, std::size_t N>
+template <typename T, usz N>
 class lf_array
 {
 	// Data (default-initialized)
@@ -28,7 +28,7 @@ public:
 		}
 	}
 
-	T& operator [](std::size_t index)
+	T& operator [](usz index)
 	{
 		if (index < N) [[likely]]
 		{
@@ -51,7 +51,7 @@ public:
 
 //! Simple lock-free FIFO queue base. Based on lf_array<T, N> itself. Currently uses 32-bit counters.
 //! There is no "push_end" or "pop_begin" provided, the queue element must signal its state on its own.
-template<typename T, std::size_t N>
+template<typename T, usz N>
 class lf_fifo : public lf_array<T, N>
 {
 	// LSB 32-bit: push, MSB 32-bit: pop
@@ -307,14 +307,25 @@ public:
 		delete m_head.load();
 	}
 
-	void wait() noexcept
+	template <atomic_wait::op Flags = atomic_wait::op::eq>
+	void wait(std::nullptr_t null = nullptr) noexcept
 	{
 		if (m_head == nullptr)
 		{
-			m_head.wait(nullptr);
+			m_head.template wait<Flags>(nullptr);
 		}
 	}
 
+	const volatile void* observe() const noexcept
+	{
+		return m_head.load();
+	}
+
+	explicit operator bool() const noexcept
+	{
+		return m_head != nullptr;
+	}
+
 	template <typename... Args>
 	void push(Args&&... args)
 	{
@@ -343,9 +354,9 @@ public:
 
 	// Apply func(data) to each element, return the total length
 	template <typename F>
-	std::size_t apply(F func)
+	usz apply(F func)
 	{
-		std::size_t count = 0;
+		usz count = 0;
 
 		for (auto slice = pop_all(); slice; slice.pop_front())
 		{

Utilities/mutex.cpp

@@ -1,8 +1,10 @@
 #include "mutex.h"
 
+#include "util/asm.hpp"
+
 void shared_mutex::imp_lock_shared(u32 val)
 {
-	verify("shared_mutex underflow" HERE), val < c_err;
+	ensure(val < c_err); // "shared_mutex underflow"
 
 	for (int i = 0; i < 10; i++)
 	{
@@ -23,14 +25,14 @@ void shared_mutex::imp_lock_shared(u32 val)
 		return;
 	}
 
-	verify("shared_mutex overflow" HERE), (old % c_sig) + c_one < c_sig;
+	ensure((old % c_sig) + c_one < c_sig); // "shared_mutex overflow"
 	imp_wait();
 	lock_downgrade();
 }
 
 void shared_mutex::imp_unlock_shared(u32 old)
 {
-	verify("shared_mutex underflow" HERE), old - 1 < c_err;
+	ensure(old - 1 < c_err); // "shared_mutex underflow"
 
 	// Check reader count, notify the writer if necessary
 	if ((old - 1) % c_one == 0)
@@ -39,84 +41,6 @@ void shared_mutex::imp_unlock_shared(u32 old)
 	}
 }
 
-void shared_mutex::imp_lock_low(u32 val)
-{
-	verify("shared_mutex underflow" HERE), val < c_err;
-
-	for (int i = 0; i < 10; i++)
-	{
-		busy_wait();
-
-		if (try_lock_low())
-		{
-			return;
-		}
-	}
-
-	// Acquire writer lock and downgrade
-	const u32 old = m_value.fetch_add(c_one);
-
-	if (old == 0)
-	{
-		lock_downgrade();
-		return;
-	}
-
-	verify("shared_mutex overflow" HERE), (old % c_sig) + c_one < c_sig;
-	imp_wait();
-	lock_downgrade();
-}
-
-void shared_mutex::imp_unlock_low(u32 old)
-{
-	verify("shared_mutex underflow" HERE), old - 1 < c_err;
-
-	// Check reader count, notify the writer if necessary
-	if ((old - 1) % c_vip == 0)
-	{
-		imp_signal();
-	}
-}
-
-void shared_mutex::imp_lock_vip(u32 val)
-{
-	verify("shared_mutex underflow" HERE), val < c_err;
-
-	for (int i = 0; i < 10; i++)
-	{
-		busy_wait();
-
-		if (try_lock_vip())
-		{
-			return;
-		}
-	}
-
-	// Acquire writer lock and downgrade
-	const u32 old = m_value.fetch_add(c_one);
-
-	if (old == 0)
-	{
-		lock_downgrade_to_vip();
-		return;
-	}
-
-	verify("shared_mutex overflow" HERE), (old % c_sig) + c_one < c_sig;
-	imp_wait();
-	lock_downgrade_to_vip();
-}
-
-void shared_mutex::imp_unlock_vip(u32 old)
-{
-	verify("shared_mutex underflow" HERE), old - 1 < c_err;
-
-	// Check reader count, notify the writer if necessary
-	if ((old - 1) % c_one / c_vip == 0)
-	{
-		imp_signal();
-	}
-}
-
 void shared_mutex::imp_wait()
 {
 	while (true)
@@ -137,19 +61,19 @@ void shared_mutex::imp_wait()
 			break;
 		}
 
-		m_value.wait(old);
+		m_value.wait(old, c_sig);
 	}
 }
 
 void shared_mutex::imp_signal()
 {
 	m_value += c_sig;
-	m_value.notify_one();
+	m_value.notify_one(c_sig);
 }
 
 void shared_mutex::imp_lock(u32 val)
 {
-	verify("shared_mutex underflow" HERE), val < c_err;
+	ensure(val < c_err); // "shared_mutex underflow"
 
 	for (int i = 0; i < 10; i++)
 	{
@@ -168,13 +92,13 @@ void shared_mutex::imp_lock(u32 val)
 		return;
 	}
 
-	verify("shared_mutex overflow" HERE), (old % c_sig) + c_one < c_sig;
+	ensure((old % c_sig) + c_one < c_sig); // "shared_mutex overflow"
 	imp_wait();
 }
 
 void shared_mutex::imp_unlock(u32 old)
 {
-	verify("shared_mutex underflow" HERE), old - c_one < c_err;
+	ensure(old - c_one < c_err); // "shared_mutex underflow"
 
 	// 1) Notify the next writer if necessary
 	// 2) Notify all readers otherwise if necessary (currently indistinguishable from writers)
@@ -199,7 +123,7 @@ void shared_mutex::imp_lock_upgrade()
 	// Convert to writer lock
 	const u32 old = m_value.fetch_add(c_one - 1);
 
-	verify("shared_mutex overflow" HERE), (old % c_sig) + c_one - 1 < c_sig;
+	ensure((old % c_sig) + c_one - 1 < c_sig); // "shared_mutex overflow"
 
 	if (old % c_one == 1)
 	{
@@ -241,18 +165,3 @@ void shared_mutex::imp_lock_unlock()
 	imp_wait();
 	unlock();
 }
-
-bool shared_mutex::downgrade_unique_vip_lock_to_low_or_unlock()
-{
-	return m_value.atomic_op([](u32& value)
-	{
-		if (value % c_one / c_vip == 1)
-		{
-			value -= c_vip - 1;
-			return true;
-		}
-
-		value -= c_vip;
-		return false;
-	});
-}

Utilities/mutex.h

@@ -1,7 +1,7 @@
 #pragma once
 
 #include <mutex>
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
 
 // Shared mutex with small size (u32).
@@ -12,17 +12,12 @@ class shared_mutex final
 		c_one = 1u << 14, // Fixed-point 1.0 value (one writer, max_readers = c_one - 1)
 		c_sig = 1u << 30,
 		c_err = 1u << 31,
-		c_vip = 1u << 7,
 	};
 
 	atomic_t<u32> m_value{};
 
 	void imp_lock_shared(u32 val);
 	void imp_unlock_shared(u32 old);
-	void imp_lock_low(u32 val);
-	void imp_unlock_low(u32 old);
-	void imp_lock_vip(u32 val);
-	void imp_unlock_vip(u32 old);
 	void imp_wait();
 	void imp_signal();
 	void imp_lock(u32 val);
@@ -88,64 +83,6 @@ public:
 		}
 	}
 
-	bool try_lock_low()
-	{
-		const u32 value = m_value.load();
-
-		// Conditional increment
-		return value < c_vip - 1 && m_value.compare_and_swap_test(value, value + 1);
-	}
-
-	void lock_low()
-	{
-		const u32 value = m_value.load();
-
-		if (value >= c_vip - 1 || !m_value.compare_and_swap_test(value, value + 1)) [[unlikely]]
-		{
-			imp_lock_low(value);
-		}
-	}
-
-	void unlock_low()
-	{
-		// Unconditional decrement (can result in broken state)
-		const u32 value = m_value.fetch_sub(1);
-
-		if (value >= c_one) [[unlikely]]
-		{
-			imp_unlock_low(value);
-		}
-	}
-
-	bool try_lock_vip()
-	{
-		const u32 value = m_value.load();
-
-		// Conditional increment
-		return (value < c_one - 1 || value & (c_one - c_vip)) && (value % c_vip) == 0 && m_value.compare_and_swap_test(value, value + c_vip);
-	}
-
-	void lock_vip()
-	{
-		const u32 value = m_value.load();
-
-		if ((value >= c_one - 1 && !(value & (c_one - c_vip))) || (value % c_vip) || !m_value.compare_and_swap_test(value, value + c_vip)) [[unlikely]]
-		{
-			imp_lock_vip(value);
-		}
-	}
-
-	void unlock_vip()
-	{
-		// Unconditional decrement (can result in broken state)
-		const u32 value = m_value.fetch_sub(c_vip);
-
-		if (value >= c_one) [[unlikely]]
-		{
-			imp_unlock_vip(value);
-		}
-	}
-
 	bool try_lock()
 	{
 		return m_value.compare_and_swap_test(0, c_one);
@@ -214,12 +151,6 @@ public:
 		m_value -= c_one - 1;
 	}
 
-	void lock_downgrade_to_vip()
-	{
-		// Convert to vip lock (can result in broken state)
-		m_value -= c_one - c_vip;
-	}
-
 	// Optimized wait for lockability without locking, relaxed
 	void lock_unlock()
 	{
@@ -240,12 +171,9 @@ public:
 	{
 		return m_value.load() < c_one - 1;
 	}
-
-	// Special purpose logic
-	bool downgrade_unique_vip_lock_to_low_or_unlock();
 };
 
-// Simplified shared (reader) lock implementation. Mutually incompatible with low_lock and vip_lock.
+// Simplified shared (reader) lock implementation.
 class reader_lock final
 {
 	shared_mutex& m_mutex;
@@ -283,47 +211,3 @@ public:
 		m_upgraded ? m_mutex.unlock() : m_mutex.unlock_shared();
 	}
 };
-
-// Special shared (reader) lock, mutually exclusive with vip locks. Mutually incompatible with normal shared (reader) lock.
-class low_lock final
-{
-	shared_mutex& m_mutex;
-
-public:
-	low_lock(const low_lock&) = delete;
-
-	low_lock& operator=(const low_lock&) = delete;
-
-	explicit low_lock(shared_mutex& mutex)
-		: m_mutex(mutex)
-	{
-		m_mutex.lock_low();
-	}
-
-	~low_lock()
-	{
-		m_mutex.unlock_low();
-	}
-};
-
-// Special shared (reader) lock, mutually exclusive with low locks. Mutually incompatible with normal shared (reader) lock.
-class vip_lock final
-{
-	shared_mutex& m_mutex;
-
-public:
-	vip_lock(const vip_lock&) = delete;
-
-	vip_lock& operator=(const vip_lock&) = delete;
-
-	explicit vip_lock(shared_mutex& mutex)
-		: m_mutex(mutex)
-	{
-		m_mutex.lock_vip();
-	}
-
-	~vip_lock()
-	{
-		m_mutex.unlock_vip();
-	}
-};

Utilities/rXml.cpp

@@ -1,7 +1,5 @@
 #include "stdafx.h"
-#include "restore_new.h"
 #include "Utilities/rXml.h"
-#include "define_new_memleakdetect.h"
 
 rXmlNode::rXmlNode() : handle()
 {
@@ -54,7 +52,7 @@ std::string rXmlNode::GetAttribute(const std::string &name)
 
 std::string rXmlNode::GetNodeContent()
 {
-	return handle.text().get(); 
+	return handle.text().get();
 }
 
 rXmlDocument::rXmlDocument() : handle()
@@ -70,4 +68,3 @@ std::shared_ptr<rXmlNode> rXmlDocument::GetRoot()
 {
 	return std::make_shared<rXmlNode>(handle.root());
 }
-

Utilities/rXml.h

@@ -1,4 +1,4 @@
-#pragma once
+#pragma once
 
 #include <pugixml.hpp>
 #include <memory>

Utilities/sema.cpp

@@ -1,5 +1,7 @@
 #include "sema.h"
 
+#include "util/asm.hpp"
+
 void semaphore_base::imp_wait()
 {
 	for (int i = 0; i < 10; i++)
@@ -52,7 +54,7 @@ void semaphore_base::imp_wait()
 
 void semaphore_base::imp_post(s32 _old)
 {
-	verify("semaphore_base: overflow" HERE), _old < 0;
+	ensure(_old < 0); // "semaphore_base: overflow"
 
 	m_value.notify_one();
 }

Utilities/sema.h

@@ -1,7 +1,7 @@
 #pragma once
 
 #include <mutex>
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
 
 // Lightweight semaphore helper class

Utilities/sync.h

@@ -2,11 +2,14 @@
 
 /* For internal use. Don't include. */
 
-#include "types.h"
+#include "util/types.hpp"
 #include "util/atomic.hpp"
-#include "dynamic_library.h"
+#include "util/dyn_lib.hpp"
 
 #ifdef _WIN32
+#ifndef NOMINMAX
+#define NOMINMAX
+#endif
 #include <Windows.h>
 #include <time.h>
 #elif __linux__
@@ -15,6 +18,7 @@
 #include <linux/futex.h>
 #include <sys/time.h>
 #include <unistd.h>
+#include <fcntl.h>
 #endif
 #include <algorithm>
 #include <ctime>
@@ -28,6 +32,12 @@ DYNAMIC_IMPORT("ntdll.dll", NtWaitForKeyedEvent, NTSTATUS(HANDLE, PVOID Key, BOO
 DYNAMIC_IMPORT("ntdll.dll", NtReleaseKeyedEvent, NTSTATUS(HANDLE, PVOID Key, BOOLEAN Alertable, PLARGE_INTEGER Timeout));
 DYNAMIC_IMPORT("ntdll.dll", NtWaitForSingleObject, NTSTATUS(HANDLE Handle, BOOLEAN Alertable, PLARGE_INTEGER Timeout));
 DYNAMIC_IMPORT("ntdll.dll", NtDelayExecution, NTSTATUS(BOOLEAN Alertable, PLARGE_INTEGER DelayInterval));
+DYNAMIC_IMPORT("ntdll.dll", NtWaitForAlertByThreadId, NTSTATUS(PVOID Address, PLARGE_INTEGER Timeout));
+DYNAMIC_IMPORT("ntdll.dll", NtAlertThreadByThreadId, NTSTATUS(DWORD_PTR ThreadId));
+
+constexpr NTSTATUS NTSTATUS_SUCCESS = 0;
+constexpr NTSTATUS NTSTATUS_ALERTED = 0x101;
+constexpr NTSTATUS NTSTATUS_TIMEOUT = 0x102;
 #endif
 
 #ifndef __linux__
@@ -61,7 +71,7 @@ inline int futex(volatile void* uaddr, int futex_op, uint val, const timespec* t
 		};
 
 		std::mutex mutex;
-		std::unordered_multimap<volatile void*, waiter*, pointer_hash<volatile void, alignof(int)>> map;
+		std::unordered_multimap<volatile void*, waiter*> map;
 
 		int operator()(volatile void* uaddr, int futex_op, uint val, const timespec* timeout, uint mask)
 		{

Utilities/sysinfo.h

@@ -1,69 +0,0 @@
-#pragma once
-
-#include "types.h"
-#include <string>
-
-namespace utils
-{
-	inline std::array<u32, 4> get_cpuid(u32 func, u32 subfunc)
-	{
-		int regs[4];
-#ifdef _MSC_VER
-		__cpuidex(regs, func, subfunc);
-#else
-		__asm__ volatile("cpuid" : "=a" (regs[0]), "=b" (regs[1]), "=c" (regs[2]), "=d" (regs[3]) : "a" (func), "c" (subfunc));
-#endif
-		return {0u+regs[0], 0u+regs[1], 0u+regs[2], 0u+regs[3]};
-	}
-
-	inline u64 get_xgetbv(u32 xcr)
-	{
-#ifdef _MSC_VER
-		return _xgetbv(xcr);
-#else
-		u32 eax, edx;
-		__asm__ volatile( "xgetbv" : "=a"(eax), "=d"(edx) : "c"(xcr));
-		return eax | (u64(edx) << 32);
-#endif
-	}
-
-	bool has_ssse3();
-
-	bool has_sse41();
-
-	bool has_avx();
-
-	bool has_avx2();
-
-	bool has_rtm();
-
-	bool has_tsx_force_abort();
-
-	bool has_mpx();
-
-	bool has_avx512();
-
-	bool has_xop();
-
-	bool has_clwb();
-
-	bool has_invariant_tsc();
-
-	bool has_fma3();
-
-	bool has_fma4();
-
-	std::string get_cpu_brand();
-
-	std::string get_system_info();
-
-	std::string get_firmware_version();
-
-	std::string get_OS_version();
-
-	ullong get_tsc_freq();
-
-	u64 get_total_memory();
-
-	u32 get_thread_count();
-}

Utilities/version.cpp

@@ -1,6 +1,8 @@
 #include "stdafx.h"
 #include "version.h"
 
+#include <regex>
+
 namespace utils
 {
 	std::string to_string(version_type type)
@@ -48,4 +50,51 @@ namespace utils
 
 		return version;
 	}
+
+	// Based on https://www.geeksforgeeks.org/compare-two-version-numbers/
+	int compare_versions(const std::string& v1, const std::string& v2, bool& ok)
+	{
+		// Check if both version strings are valid
+		ok = std::regex_match(v1, std::regex("[0-9.]*")) && std::regex_match(v2, std::regex("[0-9.]*"));
+
+		if (!ok)
+		{
+			return -1;
+		}
+
+		// vnum stores each numeric part of version
+		int vnum1 = 0;
+		int vnum2 = 0;
+
+		// Loop until both strings are processed
+		for (usz i = 0, j = 0; (i < v1.length() || j < v2.length());)
+		{
+			// Storing numeric part of version 1 in vnum1
+			while (i < v1.length() && v1[i] != '.')
+			{
+				vnum1 = vnum1 * 10 + (v1[i] - '0');
+				i++;
+			}
+
+			// Storing numeric part of version 2 in vnum2
+			while (j < v2.length() && v2[j] != '.')
+			{
+				vnum2 = vnum2 * 10 + (v2[j] - '0');
+				j++;
+			}
+
+			if (vnum1 > vnum2)
+				return 1;
+
+			if (vnum2 > vnum1)
+				return -1;
+
+			// If equal, reset variables and go for next numeric part
+			vnum1 = vnum2 = 0;
+			i++;
+			j++;
+		}
+
+		return 0;
+	}
 }

Utilities/version.h

@@ -1,6 +1,6 @@
 #pragma once
 
-#include "types.h"
+#include "util/types.hpp"
 #include <string>
 
 namespace utils
@@ -69,4 +69,7 @@ namespace utils
 		uint to_hex() const;
 		std::string to_string() const;
 	};
+
+	// Generic version comparison (e.g. 0.0.5 vs 1.3)
+	int compare_versions(const std::string& v1, const std::string& v2, bool& ok);
 }

Vulkan/CMakeLists.txt

@@ -6,3 +6,7 @@ set(ENABLE_HLSL OFF CACHE BOOL "Enables HLSL input support" FORCE)
 set(ENABLE_OPT OFF CACHE BOOL "Enables spirv-opt capability if present" FORCE)
 set(ENABLE_CTEST OFF CACHE BOOL "Enables testing" FORCE)
 add_subdirectory(glslang)
+
+set(SKIP_SPIRV_TOOLS_INSTALL ON CACHE BOOL "Skip spirv-tools install" FORCE)
+set(SPIRV-Headers_SOURCE_DIR "${CMAKE_CURRENT_SOURCE_DIR}/spirv-headers" CACHE STRING "spirv-headers path" FORCE)
+add_subdirectory(spirv-tools)

Vulkan/glslang-build/glslang-build.vcxproj

@@ -38,29 +38,24 @@
   </ImportGroup>
   <PropertyGroup Label="UserMacros">
     <CmakeGenerator>"Visual Studio $(VisualStudioVersion.Substring(0,2))"</CmakeGenerator>
+    <CmakeCLI>cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang</CmakeCLI>
   </PropertyGroup>
   <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
-    <NMakeBuildCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeBuildCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeBuildCommandLine>
-    <NMakeReBuildCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeReBuildCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeReBuildCommandLine>
-    <NMakeCleanCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeCleanCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeCleanCommandLine>
   </PropertyGroup>
   <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
-    <NMakeBuildCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeBuildCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
     </NMakeBuildCommandLine>
-    <NMakeReBuildCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeReBuildCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
     </NMakeReBuildCommandLine>
-    <NMakeCleanCommandLine>
-      cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
+    <NMakeCleanCommandLine>$(CmakeCLI)
       msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
     </NMakeCleanCommandLine>
   </PropertyGroup>

Vulkan/spirv-tools-build/spirv-tools-build.vcxproj

@@ -0,0 +1,68 @@
+<?xml version="1.0" encoding="utf-8"?>
+<Project DefaultTargets="Build" ToolsVersion="14.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
+  <ItemGroup Label="ProjectConfigurations">
+    <ProjectConfiguration Include="Debug|x64">
+      <Configuration>Debug</Configuration>
+      <Platform>x64</Platform>
+    </ProjectConfiguration>
+    <ProjectConfiguration Include="Release|x64">
+      <Configuration>Release</Configuration>
+      <Platform>x64</Platform>
+    </ProjectConfiguration>
+  </ItemGroup>
+  <PropertyGroup Label="Globals">
+    <ProjectGuid>{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}</ProjectGuid>
+    <Keyword>MakeFileProj</Keyword>
+  </PropertyGroup>
+  <Import Project="..\..\common_default.props" />
+  <Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
+  <Import Project="..\..\common_default_macros.props" />
+  <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
+    <ConfigurationType>Makefile</ConfigurationType>
+    <UseDebugLibraries>true</UseDebugLibraries>
+  </PropertyGroup>
+  <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="Configuration">
+    <ConfigurationType>Makefile</ConfigurationType>
+    <UseDebugLibraries>false</UseDebugLibraries>
+  </PropertyGroup>
+  <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <ImportGroup Label="ExtensionSettings">
+  </ImportGroup>
+  <ImportGroup Label="Shared">
+  </ImportGroup>
+  <ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
+    <Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
+  </ImportGroup>
+  <ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
+    <Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
+  </ImportGroup>
+  <PropertyGroup Label="UserMacros">
+    <CmakeGenerator>"Visual Studio $(VisualStudioVersion.Substring(0,2))"</CmakeGenerator>
+    <CmakeCLI>cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT -DSPIRV-Headers_SOURCE_DIR=$([System.IO.Path]::GetFullPath('$(MSBuildThisFileDirectory)../spirv-headers')) ../spirv-tools</CmakeCLI>
+    <PropsAbsPath>$([System.IO.Path]::GetFullPath('$(MSBuildThisFileDirectory)..\..\common_default.props'))</PropsAbsPath>
+  </PropertyGroup>
+  <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
+    <NMakeBuildCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeBuildCommandLine>
+    <NMakeReBuildCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeReBuildCommandLine>
+    <NMakeCleanCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeCleanCommandLine>
+  </PropertyGroup>
+  <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
+    <NMakeBuildCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
+    </NMakeBuildCommandLine>
+    <NMakeReBuildCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
+    </NMakeReBuildCommandLine>
+    <NMakeCleanCommandLine>$(CmakeCLI)
+      msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
+    </NMakeCleanCommandLine>
+  </PropertyGroup>
+  <ItemDefinitionGroup>
+  </ItemDefinitionGroup>
+  <Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />
+  <ImportGroup Label="ExtensionTargets">
+  </ImportGroup>
+</Project>

Vulkan/spirv-tools-build/spirv-tools-build.vcxproj.filters

@@ -0,0 +1,2 @@
+<?xml version="1.0" encoding="utf-8"?>
+<Project ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" />

asmjitsrc/asmjit.vcxproj

@@ -5,10 +5,6 @@
       <Configuration>Debug - LLVM</Configuration>
       <Platform>x64</Platform>
     </ProjectConfiguration>
-    <ProjectConfiguration Include="Debug - MemLeak|x64">
-      <Configuration>Debug - MemLeak</Configuration>
-      <Platform>x64</Platform>
-    </ProjectConfiguration>
     <ProjectConfiguration Include="Debug|x64">
       <Configuration>Debug</Configuration>
       <Platform>x64</Platform>
@@ -96,6 +92,9 @@
     <CharacterSet>Unicode</CharacterSet>
   </PropertyGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
+  <PropertyGroup>
+    <PreferredToolArchitecture>x64</PreferredToolArchitecture>
+  </PropertyGroup>
   <ImportGroup Label="ExtensionSettings">
   </ImportGroup>
   <ImportGroup Label="PropertySheets">
@@ -105,10 +104,6 @@
   <ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
     <Import Project="..\rpcs3_debug.props" />
   </ImportGroup>
-  <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug - MemLeak|x64'" Label="PropertySheets">
-    <Import Project="..\rpcs3_debug.props" />
-    <Import Project="..\rpcs3_memleak.props" />
-  </ImportGroup>
   <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug - LLVM|x64'" Label="PropertySheets">
     <Import Project="..\rpcs3_debug.props" />
     <Import Project="..\rpcs3_llvm.props" />
@@ -125,6 +120,7 @@
     <ClCompile>
       <PrecompiledHeader>NotUsing</PrecompiledHeader>
       <PreprocessorDefinitions>ASMJIT_STATIC;%(PreprocessorDefinitions)</PreprocessorDefinitions>
+      <Optimization Condition="'$(Configuration)|$(Platform)'=='Release - LLVM|x64'">MaxSpeed</Optimization>
     </ClCompile>
   </ItemDefinitionGroup>
   <Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />

azure-pipelines.yml

@@ -17,10 +17,12 @@ jobs:
         COMPILER: clang
       GCC:
         COMPILER: gcc
-        DEPLOY_APPIMAGE: true
   variables:
     CCACHE_DIR: $(Pipeline.Workspace)/ccache
     IS_AZURE: true
+    UPLOAD_COMMIT_HASH: d812f1254a1157c80fd402f94446310560f54e5f
+    UPLOAD_REPO_FULL_NAME: "RPCS3/rpcs3-binaries-linux"
+    DEPLOY_APPIMAGE: true
   pool:
     vmImage: 'ubuntu-latest'
   steps:
@@ -31,38 +33,54 @@ jobs:
     displayName: ccache
 
   - bash: |
-      docker pull --quiet rpcs3/rpcs3-travis-xenial:1.2
+      docker pull --quiet rpcs3/rpcs3-travis-xenial:1.7
       docker run                      \
         -v $(pwd):/rpcs3              \
-        --env-file .ci/travis.env \
+        --env-file .ci/docker.env \
         -v $CCACHE_DIR:/root/.ccache  \
         -v $BUILD_ARTIFACTSTAGINGDIRECTORY:/root/artifacts \
-        rpcs3/rpcs3-travis-xenial:1.2 \
+        rpcs3/rpcs3-travis-xenial:1.7 \
         /rpcs3/.ci/build-linux.sh
     displayName: Docker setup and build
 
   - publish: $(Build.ArtifactStagingDirectory)
-    condition: eq(variables['COMPILER'], 'gcc')
+    condition: succeeded()
+    artifact: RPCS3 for Linux ($(COMPILER))
+
+  - bash: .ci/github-upload.sh
+    condition: and(ne(variables['Build.Reason'], 'PullRequest'), eq(variables['Build.Repository.Name'], 'RPCS3/rpcs3'), eq(variables['Build.SourceBranch'], 'refs/heads/master'), eq(variables['COMPILER'], 'gcc'))
+    displayName: Push build to GitHub
+    env:
+      RPCS3_TOKEN: $(RPCS3-Token)
 
 - job: Windows_Build
   variables:
     COMPILER: msvc
-    QT_VER: '5.14.1'
-    QT_DATE: '202001240957'
-    QTDIR: C:\Qt\$(QT_VER)\msvc2017_64
-    VULKAN_VER: '1.1.126.0'
-    VULKAN_SDK_SHA: 'ee86f25580b550390ce46508415e744d62e87e9c0de6cd299998058253a2a4ba'
+    QT_VER_MAIN: '5'
+    QT_VER: '5.15.2'
+    QT_VER_MSVC: 'msvc2019'
+    QT_DATE: '202011130602'
+    QTDIR: C:\Qt\$(QT_VER)\$(QT_VER_MSVC)_64
+    VULKAN_VER: '1.2.154.1'
+    VULKAN_SDK_SHA: 'b64471f3a720e649c1fae6535ea83b8c642655ebed1485bfdf15bf4d88f746d9'
     VULKAN_SDK: C:\VulkanSDK\$(VULKAN_VER)
     CACHE_DIR: ./cache
+    UPLOAD_COMMIT_HASH: 7d09e3be30805911226241afbb14f8cdc2eb054e
+    UPLOAD_REPO_FULL_NAME: "RPCS3/rpcs3-binaries-win"
 
   pool:
     vmImage: "windows-latest"
 
   steps:
+    - bash: .ci/get_keys-windows.sh
+      displayName: Get Cache Keys
+
     - task: Cache@2
       inputs:
-        key: $(Agent.OS) | $(COMPILER)
+        key: $(Agent.OS) | $(COMPILER) | "$(QT_VER)" | $(VULKAN_SDK_SHA) | llvm.lock | glslang.lock
         path: $(CACHE_DIR)
+        restoreKeys: |
+          $(Agent.OS) | $(COMPILER)
       displayName: Cache
 
     - bash: .ci/setup-windows.sh
@@ -71,10 +89,18 @@ jobs:
     - bash: .ci/export-azure-vars.sh
       displayName: Export Variables
 
+    - task: MSBuild@1
+      inputs:
+        solution: './Vulkan/spirv-tools-build/spirv-tools-build.vcxproj'
+        maximumCpuCount: true
+        platform: x64
+        configuration: 'Release'
+      displayName: Compile SPIRV-Tools
+
     - task: VSBuild@1
       inputs:
         solution: 'rpcs3.sln'
-        msbuildArgs: '/m'
+        maximumCpuCount: true
         platform: x64
         configuration: 'Release - LLVM'
       displayName: Compile RPCS3
@@ -83,18 +109,11 @@ jobs:
       displayName: Pack up build artifacts
 
     - publish: $(Build.ArtifactStagingDirectory)
-      artifact: Windows App Bundle
+      condition: succeeded()
+      artifact: RPCS3 for Windows
 
-    - task: GitHubRelease@1
-      condition: eq(variables['Build.SourceBranch'], 'refs/heads/master')
-      inputs:
-        gitHubConnection: 'RPCS3-Token'
-        repositoryName: 'RPCS3/rpcs3-binaries-win'
-        releaseNotesFilePath: 'GitHubReleaseMessage.txt'
-        action: 'create'
-        target: '7d09e3be30805911226241afbb14f8cdc2eb054e'
-        tagSource: 'userSpecifiedTag'
-        tag: 'build-$(Build.SourceVersion)'
-        title: $(AVVER)
-        addChangeLog: false
+    - bash: .ci/github-upload.sh
+      condition: and(ne(variables['Build.Reason'], 'PullRequest'), eq(variables['Build.Repository.Name'], 'RPCS3/rpcs3'), eq(variables['Build.SourceBranch'], 'refs/heads/master'))
       displayName: Push build to GitHub
+      env:
+        RPCS3_TOKEN: $(RPCS3-Token)

bin/GuiConfigs/Nekotekina by GooseWing.qss

@@ -0,0 +1,465 @@
+/*
+Nekotekina Theme for RPCS3 by GooseWing
+v1.0
+
+Based on YoRHa Theme for RPCS3
+by Ani @ https://github.com/AniLeo
+r1 (2018.02.27)
+sorry for stealing
+*/
+
+/*
+Color Scheme
+
+- Kot Programs
+8c806a
+bd9d86
+c1b398
+eadfb1
+ebe4d2
+
+- Light
+ffd785
+bfa163
+
+- Dark
+705722
+5c471c
+4d4940
+*/
+
+
+/* Every widget */
+QWidget {
+	font-family: SCE-PS3 Rodin LATIN;
+	font-size: 9.00pt;
+
+	color: #ffd785;
+	background: transparent;
+	alternate-background-color: transparent;
+}
+
+
+/* Debugger: Sets font-family to default (any invalid value could be provided) */
+#debugger QListWidget, #debugger QTextEdit {
+	font-family: none;
+}
+
+
+/* Log+TTY: Use flat dark color background with default font for better readability */
+#log_frame, #tty_frame {
+	background: rgba(52, 49, 40, 0.9);
+	font-size: 8.50pt;
+	font-family: none;
+}
+
+
+/* Debugger: Restore original font size */
+#debugger QListWidget, #debugger QTextEdit {
+	font-size: 9.50pt;
+}
+
+
+/* LLE: Style QListWidget checkboxes (QListWidget) */
+#lleList::indicator {
+	border: 0.05em solid #4d4940;
+}
+#lleList::indicator::unchecked {
+	background-color: #b3ac98;
+}
+#lleList::indicator::checked {
+	background-color: #4d4940;
+}
+#lleList::indicator::disabled {
+	background-color: #828790;
+}
+#lleList::item::selected {
+	color: #4d4940;
+}
+
+
+/* Mouse Tooltips */
+QToolTip {
+	background-color: #705722;
+	color: #ffd785;
+	border: 0.10em solid #705722;
+}
+
+
+/* CG Disasm and Trophy Manager: background-image doesn't work, use static color */
+QWidget#cg_disasm, QWidget#trophy_manager {
+	background: #6e695c;
+}
+
+
+/* Main Window and Dialogs */
+QDialog, QMainWindow#main_window {
+	border-image: url("GuiConfigs/kot-bg.jpg");
+}
+
+
+/* Table headers */
+QHeaderView::section {
+	text-transform: uppercase;
+	background: #bfa163;
+	color: #4d4940;
+	padding-left: 0.15em;
+	padding-top: 0.15em;
+	padding-bottom: 0.10em;
+	text-transform: uppercase;
+	border: none;
+}
+
+
+/* All other Tabs */
+QTabBar {
+	text-transform: uppercase;
+}
+
+QTabBar::tab {
+	background: transparent;
+	padding-left: 0.50em;
+	padding-right: 0.50em;
+	padding-top: 0.25em;
+	padding-bottom: 0.25em;
+	margin-right: 0.25em;
+}
+QTabBar::tab::selected {
+	background: #705722;
+	color: #ffd785;
+	border-bottom-style: solid;
+}
+
+
+/* Settings Dialog: Tabs */
+QTabBar#tab_bar_settings {
+	border-bottom: 0.05em solid #705722;
+	text-transform: uppercase;
+}
+QTabBar::tab#tab_bar_settings {
+	background: transparent;
+	width: 5.20em;
+	padding-left: 0.50em;
+	padding-right: 0.50em;
+	padding-top: 0.65em;
+	padding-bottom: 0.65em;
+	margin-right: 0.25em;
+	font-size: 10.5pt;
+	font-weight: 550;
+}
+QTabBar::tab:last#tab_bar_settings {
+	margin-right: 0em;
+}
+QTabBar::tab:!selected:hover#tab_bar_settings {
+	background: transparent;
+	color: #705722;
+}
+QTabBar::tab::selected#tab_bar_settings {
+	background: #bfa163;
+	color: #705722;
+	border-bottom-style: solid;
+	margin-top: 0.15em;
+}
+
+
+/* Checkboxes */
+QCheckBox::indicator {
+	border-radius: 0.1em;
+	border: 0.05em solid #5c471c;
+	margin-top: 0.05em;
+	width: 0.8em;
+	height: 0.8em;
+}
+QCheckBox::indicator:checked {
+	background-color: #ffd785; /* Light */
+}
+QCheckBox::indicator:unchecked {
+	background-color: #705722; /* Dark */
+}
+QCheckBox::indicator::disabled {
+	background-color: #828790; /* Gray */
+}
+
+
+/* Radio Buttons */
+QRadioButton::indicator {
+	border-radius: 0.4em;
+	border: 0.05em solid #5c471c;
+	width: 0.8em;
+	height: 0.8em;
+}
+QRadioButton::indicator:checked {
+	background-color: #ffd785; /* Light */
+}
+QRadioButton::indicator:unchecked {
+	background-color: #705722; /* Dark */
+}
+QRadioButton::indicator::disabled {
+	background-color: #828790; /* Gray */
+}
+
+
+/* Combo Boxes */
+QComboBox {
+	background: transparent;
+	color: #ffd785;
+	border: 0.05em solid #ffd785;
+	border-radius: 0.15em;
+	padding-bottom: 0.2em;
+	padding-left: 0.4em;
+}
+QComboBox QAbstractItemView {
+	background: #bfa163;
+	color: #4d4940;
+}
+QComboBox::disabled {
+	background: #828790;
+	color: #4d4940;
+}
+
+
+/* Group Boxes (Settings Dialog) */
+QGroupBox {
+	margin-top: 1em;
+	border: 0.05em solid #ffd785;
+	text-transform: uppercase;
+	font-size: 9.25pt;
+	background-color: rgba(41,41,41,120);
+}
+QGroupBox::title {
+	subcontrol-origin: margin;
+	subcontrol-position: top;
+	padding: 0.3em 0.5em 0.3em 0.5em;
+	color: #ffd785;
+}
+
+
+/* Buttons */
+QPushButton {
+	background: #b89754;
+	color: #292929;
+}
+QPushButton::disabled {
+	background: #828790;
+	color: #ffffff;
+}
+
+
+/* QSpinBox (Settings -> Emulator -> width/height) */
+/* QDoubleSpinBox (Pads -> Mouse Acceleration -> x/y) */
+QSpinBox, QDoubleSpinBox {
+	background: transparent;
+	/*background-color: #bfa163;*/
+	border: 0.05em solid #4d4940;
+	border-radius: 0.10em;
+	color: #ffd785;
+}
+
+
+/* Styles Sliders */
+QSlider::groove:horizontal {
+	border: 0.10em solid #ffd785;
+	border-radius: 0.10em;
+}
+
+QSlider::handle:horizontal {
+	background: #ffd785;
+	width: 0.50em;
+}
+
+QSlider#sizeSlider::groove:horizontal {
+	border: 0.10em solid #ffd785;
+	border-radius: 0.10em;
+	height: 1.5em;
+}
+
+/* Log and Debugger borders */
+QTextEdit {
+	border: 0.05em solid #4d4940;
+}
+
+
+/* For dock buttons to be visible */
+QDockWidget {
+	background: transparent;
+	text-transform: uppercase;
+	color: #4d4940;
+	font-weight: 500;
+}
+[floating="true"] {
+	border-image: url("GuiConfigs/kot-bg.jpg");
+}
+QDockWidget::title {
+	background: #bfa163;
+	padding-top: 0.2em;
+}
+QDockWidget::close-button, QDockWidget::float-button {
+	background-color: #bfa163;
+}
+
+
+/* Disable ugly borders */
+QTabWidget::pane {
+	border: 0em solid #4d4940;
+}
+
+
+/* Top menu bar */
+QMenuBar {
+	height:1.50em;
+	text-transform: uppercase;
+}
+QMenuBar::item {
+	margin-right: 0.20em;
+	margin-left: 0.20em;
+	padding-left: 1.20em;
+	padding-right: 1.20em;
+}
+QMenuBar::item:selected {
+	background: #4d4940;
+	color: #aea993;
+}
+
+
+QMenu {
+	background: #bfa163;
+	color: #4d4940;
+	text-transform: uppercase;
+}
+QMenu::item {
+	padding-left: 1.5em;
+	padding-right: 0.75em;
+	padding-top: 0.25em;
+	padding-bottom: 0.25em;
+
+}
+QMenu::item:selected {
+	background: #4d4940;
+	color: #aea993;
+	border: 0.05em solid #4d4940;
+}
+QMenu::item:disabled {
+	background-color: #828790;
+	color: #4d4940;
+}
+
+
+/* Pad Settings: Controller Image */
+QLabel#l_controller {
+	color: #ffd785;
+}
+
+
+/* Game Grid Font */
+QTableWidget#game_grid {
+	font-weight: 600;
+	color: #4d4940;
+	text-transform: uppercase;
+	selection-color: #aea993;
+}
+QTableWidget#game_grid::item:selected:active {
+	selection-background-color: #4d4940;
+}
+QTableWidget#game_grid::item:selected:!active {
+	selection-background-color: #615c51;
+}
+
+
+/* Debug UI Settings buttons */
+QLabel#color_button {
+	background: transparent;
+}
+
+
+/* Search bar on main Toolbar */
+QLineEdit#mw_searchbar {
+	margin-left: 0.7em;
+	color: #4d4940;
+	font-size: 10.25pt;
+}
+
+
+/* Uniform colors in Toolbar */
+QToolButton {
+	background: transparent;
+	text-transform: uppercase;
+}
+QToolButton::hover {
+	background-color: #b3ac98;
+}
+
+
+/* Set Theme UI colors */
+QLabel#gamelist_icon_background_color {
+	color: transparent;
+}
+
+
+/* Set Windows Taskbar Thumbnail colors */
+QLabel#thumbnail_icon_color {
+	color: #4d4940;
+}
+
+
+QLabel#log_level_always {
+	color: #00ffff; /* Cyan */
+}
+QLabel#log_level_fatal {
+	color: #ff00ff; /* Fuchsia */
+}
+QLabel#log_level_error {
+	color: #ff0000; /* Red */
+}
+QLabel#log_level_todo {
+	color: #ff6000; /* Orange */
+}
+QLabel#log_level_success {
+	color: #00ff00; /* Green */
+}
+QLabel#log_level_warning {
+	color: #ffff00; /* Yellow */
+}
+QLabel#log_level_notice {
+	color: #ffffff; /* White */
+}
+QLabel#log_level_trace {
+	color: #808080; /* Gray */
+}
+QLabel#log_stack {
+	color: #b3ac98; /* Light */
+}
+
+/* Set TTY colors */
+#tty_frame {
+	color: #b3ac98; /* Light */
+}
+
+
+/* Memory Viewer */
+QLabel#memory_viewer_address_panel {
+	color: #0000ff; /* Font Color: Blue */
+}
+QLabel#memory_viewer_hex_panel {
+	color: #4d4940; /* Font Color: Grey */
+}
+QLabel#memory_viewer_ascii_panel {
+	color: #4d4940; /* Font Color: Grey */
+}
+
+
+/* Debugger colors */
+QLabel#debugger_frame_breakpoint {
+	color: #000000; /* Font Color: Black */
+	background-color: #ffff00; /* Yellow */
+}
+QLabel#debugger_frame_pc {
+	color: #000000; /* Font Color: Black */
+	background-color: #00ff00; /* Green */
+}
+
+
+/* Trophy Notification Popup */
+QWidget#trophy_notification_frame {
+	background-color: #b3ac98;
+	color: #4d4940;
+}

bin/GuiConfigs/Skyline (Nightfall).qss

@@ -460,10 +460,6 @@ QSpinBox:hover, QDoubleSpinBox:hover {
 	color: #FFFFFF;
 }
 
-QSpinBox::up-button, QSpinBox::down-button, QDoubleSpinBox::up-button, QDoubleSpinBox::down-button {
-	background: transparent;
-}
-
 QSpinBox:disabled, QDoubleSpinBox:disabled {
 	color: #455971;
 	background: #26293b;

bin/GuiConfigs/Skyline.qss

@@ -482,10 +482,6 @@ QSpinBox:hover, QDoubleSpinBox:hover {
 	color: #455971;
 }
 
-QSpinBox::up-button, QSpinBox::down-button, QDoubleSpinBox::up-button, QDoubleSpinBox::down-button {
-	background: transparent;
-}
-
 QSpinBox:disabled, QDoubleSpinBox:disabled {
 	background-color: #b3b3b3;
 	color: #455971;

bin/GuiConfigs/YoRHa by Ani.qss

@@ -71,6 +71,22 @@ QWidget {
 	color: #4d4940;
 }
 
+/* Style QTreeWidget checkboxes */
+QTreeWidget::indicator {
+	border: 0.05em solid #4d4940;
+}
+QTreeWidget::indicator::unchecked {
+	background-color: #b3ac98;
+}
+QTreeWidget::indicator::checked {
+	background-color: #4d4940;
+}
+QTreeWidget::indicator::disabled {
+	background-color: #828790;
+}
+QTreeWidget::item::selected {
+	color: #4d4940;
+}
 
 /* Mouse Tooltips */
 QToolTip {
@@ -80,14 +96,8 @@ QToolTip {
 }
 
 
-/* CG Disasm and Trophy Manager: background-image doesn't work, use static color */
-QWidget#cg_disasm, QWidget#trophy_manager {
-	background: #b3ac98;
-}
-
-
-/* Main Window and Dialogs */
-QDialog, QMainWindow#main_window {
+/* Main Window, Dialogs and some Dialogs that are actually widgets */
+QDialog, QWidget#trophy_manager, QWidget#cg_disasm, QMainWindow#main_window {
 	border-image: url("GuiConfigs/YoRHa-background.jpg");
 }