Compare commits

..

1511 Commits

Author SHA1 Message Date
Ani a86a3d2fee rpcs3_version: Bump to 0.0.12 (#8815) 2020-08-31 23:38:51 +01:00
kd-11 a917f55ef8 vk/sdk: Sync with vulkan SDK v148 (#8814)
- Sync with vulkan SDK 148
- glslang library was split into several smaller libraries
- HLSL is no longer needed
2020-09-01 00:57:38 +03:00
Ani 21b535b5c5 gui/themes: Convert kot-bg to jpg (95%) (#8809)
No perceived loss of image quality, reduces size from 8.1 MB to 2.0 MB
2020-08-31 05:35:42 +01:00
kd-11 af9e217fa4 vk: Improve D16F handling
- Adds upload and download routines. Mostly untested, which is why the error message exists
2020-08-30 09:26:37 +03:00
Bevan Weiss 9a51f22265 Remove call to start m_mousehide_timer in gs_frame constructor 2020-08-29 16:14:11 +02:00
Bevan Weiss 144b185802 Woops... premature commit/push.
Fixed up the usage of connect
2020-08-29 16:14:11 +02:00
Bevan Weiss 3c0f6a2919 Used new Qt connect syntax
Fixed indenting
Renamed click callback argument from 'val'->'checked'
Converted m_gui re-usage to just reference ui
Removed implicit capture from spinbox lambda
Corrected millisecond acronym from mS->ms
Removed superfluous QTimer include in gs_frame.cpp
2020-08-29 16:14:11 +02:00
Bevan Weiss 22c33d4fb4 Added settings and logic for auto-hide of mouse cursor.
In line with the Show Cursor in Fullscreen settings, these settings are only updated when the render window is first launched, and not during the game.
This could be revised (along with the Fullscreen Cursor) if it's more desired.
2020-08-29 16:14:11 +02:00
kd-11 e9cdb248a0 glsl: Properly implement shadow filtering when running emulated shadow compare
- Previous code was completely borked
2020-08-29 02:03:09 +01:00
kd-11 e8274d5a59 vk: Fix depth format mismatch detection in copy_image 2020-08-29 02:03:09 +01:00
Eladash 6952be5ce4 Debugger: Replace SPU register perefix '$' with 'r' 2020-08-28 20:44:13 +02:00
RipleyTom 4317291827 tcp_timeout_monitor deadlock fix (#8783) 2020-08-28 01:06:01 +01:00
Nekotekina bd40430d2b Fix some warnng in lv2.cpp 2020-08-28 01:54:39 +03:00
Nekotekina ebc4a0188a Restore some code 2020-08-28 01:54:39 +03:00
Nekotekina bfa4fcf584 Use g_fxo for progress_dialog_server 2020-08-28 01:54:39 +03:00
Eladash 48f70fbf10 Fix UB in Emulator::Load 2020-08-27 23:52:37 +01:00
Eladash 019d2d5dcf Implement HLE cellSpursAddUrgentCommand 2020-08-27 23:52:37 +01:00
Eladash 17f7f329a8 Log PRX segment end for usage with kernel explorer 2020-08-27 23:52:37 +01:00
Eladash 933737e8f0 PPU: log LR in HLE functions 2020-08-27 23:52:37 +01:00
Eladash 47b545282e SPU: Fix events ACK, minor optimizations (#8771) 2020-08-27 21:36:54 +01:00
RipleyTom 190822c2b2 RPCN Client (#8663) 2020-08-27 20:47:04 +01:00
kd-11 d000d648b0 vk: Fix some minor spec violation
- Stencil clear pass does not consume an image, do not bind one.
- Add push_barrier to allow push-pop semantics for texture barrier insert.
2020-08-27 12:52:28 +03:00
kd-11 d257ba5156 vk: Add some more diagnostic messages for unoptimized image transfer setups 2020-08-27 12:52:28 +03:00
kd-11 9828d6146b rsx: Fix format matching when aggregating textures
- When copying depth-depth, prefer own format over depth int format
2020-08-27 12:52:28 +03:00
kd-11 9e4bec8cec vk: Fix some missing render target declarations 2020-08-27 12:52:28 +03:00
kd-11 65ead08880 rsx: Refactor and improve image memory manipulation routines 2020-08-27 12:52:28 +03:00
kd-11 f6c6c04648 vk: Implement transport for D24S8_FLOAT data 2020-08-27 12:52:28 +03:00
kd-11 794378d5e9 rsx: Do not create depth textures as blit engine targets. 2020-08-27 12:52:28 +03:00
kd-11 a5ac5a9861 rsx: Separate uint depth formats from float depth formats 2020-08-27 12:52:28 +03:00
kd-11 faaf28b41d rsx: Basic support for creating depth float formats 2020-08-27 12:52:28 +03:00
GooseWing 700c540434 Add Nekotekina skin (#8776)
* adding kots

* More sharper neko on background

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-08-27 07:15:24 +02:00
RipleyTom c177bf7480 Forces MSVC Toolkit to 14.25.28610 in Azure Pipelines 2020-08-27 06:39:46 +02:00
Eladash bccfb1cda7 Fix empty input in Registers Editor 2020-08-26 08:20:16 +02:00
Eladash c099bb817f Debugger: Disable PPU address redirection
It causes more confusion than it helps.
2020-08-25 17:43:07 +02:00
Eladash 7fe98d8d66 Debugger: Add missing PPU stack register checks 2020-08-25 17:43:07 +02:00
Eladash d356e0d1e7 Debugger: Register Editor Improvements 2020-08-25 17:43:07 +02:00
Eladash 3ce7fd7894 Debugger: Fix instructions editor 2020-08-25 17:43:07 +02:00
Eladash 6f42297b58 Debugger: Fix scrolling using PageUp, PageDown, KeyUp, KeyDown 2020-08-25 17:43:07 +02:00
Eladash c5aebe4564 Debugger: Implement PPU SLWI, SRWI, SLDI mnemonics 2020-08-24 02:10:51 +03:00
Eladash 841b8fad38 SPU: Fix timer events 2020-08-24 01:57:32 +03:00
Bevan Weiss ab0df0a0f5 Support for Namco GCon3 gun (#8757)
This gun now works (passes calibration) in Time Crisis 4.
2020-08-22 15:41:08 +02:00
Eladash 27e3317449 [HOTFIX] Fix UB in Emu/System.cpp 2020-08-22 11:55:08 +02:00
Eladash edc09e22b4 PSF: Avoid redundent string copies in psf::array/string/get_string (#8707) 2020-08-21 23:55:17 +01:00
Megamouse b487c09d34 Revert "Qt: speed up list refresh"
This reverts commit 715f4f0669.
2020-08-21 09:51:36 +02:00
Eladash 4a40ef6a19 Debugger: Use Signed Hexadecimal formatting (#8751) 2020-08-20 22:07:31 +01:00
Eladash bcddbc15f0 Debugger: Fix PPU stepping on non-TSX 2020-08-19 19:48:35 +01:00
Eladash 2a19d0a579 kernel-explorer: Add RSX handlers events info 2020-08-19 09:09:24 +02:00
Megamouse 9af66e22da evdev: log axis information in pad settings 2020-08-18 18:29:35 +02:00
Megamouse 715f4f0669 Qt: speed up list refresh 2020-08-18 11:00:04 +02:00
Megamouse e6e753f37f Qt/Linux: fix QT_AUTO_SCREEN_SCALE_FACTOR typo 2020-08-18 10:04:31 +02:00
Megamouse e958c3cc6a Qt: fix YoRHa QTreeWidget item style for CheckBoxes 2020-08-18 10:04:31 +02:00
Eladash 19500ac9ad Fix truncation warning in sys_cond.cpp 2020-08-17 17:36:27 +01:00
Eladash 25dee4a78e Fix bitops test 2020-08-17 17:36:27 +01:00
Eladash ee953f7953 Fix vm::reservation_update 2020-08-16 22:58:49 +03:00
Zion Nimchuk acee590733 Ensure pushing builds to Github is only done on master branch 2020-08-16 17:35:19 +01:00
Zion Nimchuk cd94d9849d Windows GitHub release hotfix
Improve id variable parsing and print release.json to catch error
2020-08-16 17:35:19 +01:00
Zion c3709fa744 Manually upload Windows Github Release using curl. Actually fixes #7938 (#8715)
For some reason Azure would evaluate the GitHub release instantly and
complain about missing/invalid GitHub Release deployment and fail to
even start the build, this fixes the issue by just manually uploading it
via the GitHub API and curl.
2020-08-15 20:46:53 +01:00
Eladash 853e2b90a3 rsx: Minor rsx::ceil_log2 bugfix 2020-08-15 20:39:21 +03:00
Eladash 995cb8125e SPU LLVM: Improve approx FCGT (#8728) 2020-08-14 19:33:35 +01:00
Bevan Weiss 01d3585bf3 Bring back the non-compliant define, but version limited
As noted, we've done something we shouldn't have with MSVC compiler specific defines.  But to avoid breaking the MSVC build environment, leave this define in there until the MSVC version when it is actually exposed by the compiler itself (v16.8).
2020-08-14 18:34:34 +01:00
Bevan Weiss a11afe05bf MSVC changes
Add support for compilation on x64 toolchain (x86 cl.exe was running out of heap space in vm.cpp)

Also took the opportunity to change compile optimisation from /Ox to /O2, as /O2 provides better optimisation than does /Ox

Also, we shouldn't be explicitely setting compiler tool defines (__cpp_lib_bitops), so remove that from types.h
2020-08-14 18:34:34 +01:00
Whatcookie 9e4f43f4d1 SPU LLVM: Add icelake optimized paths for SHUFB (#8712) 2020-08-13 15:00:56 +01:00
Eladash 8cdfe5952a SPU/PPU LLVM: Improve 0 addend FMA detection (#8709) 2020-08-13 04:13:08 +03:00
Eladash 0f8ca1f7c5 SPU: Implement RSX accurate reservations on TSX (#8721) 2020-08-13 00:00:37 +01:00
kd-11 fd2607ad52 rsx: Fix XBGR vs XRGB screenshots 2020-08-12 20:19:19 +03:00
kd-11 7e1b24224d rsx: Support XBGR flip image load from Cell memory 2020-08-12 20:19:19 +03:00
kd-11 56c63170b9 vk: Warn if GPU does not support RGBA8 natively 2020-08-12 20:19:19 +03:00
kd-11 b41349546c rsx: Proper support for typeless transform of ABGR framebuffers using the RGBA8 format 2020-08-12 20:19:19 +03:00
kd-11 6850533b50 rsx: Unify composite texture creation and management
- Some texture accesses require image compositing steps to assemble the requested image from existing subresources.
  Handle all the common routines in a unified manner to avoid having one broken path (e.g mipmap gather not supporting bitcast operations)
2020-08-10 13:31:22 +03:00
Whatcookie 4ce2ad54a8 PPU LLVM: Use VPERM2B to emulate VPERM (#8704)
- The VPERM2B instructions are a match of VPERM's behavior, besides operating in reverse byte order
2020-08-09 01:50:26 +01:00
Eladash 0c85d4c0d0 cellSaveData: Fix loss of "BLIST" and files' information in PARAM.SFO (#8706) 2020-08-08 23:40:47 +01:00
Eladash 57471f8c94 SPU LLVM: Fix signed zeroes handling on Accurate xfloat 2020-08-08 22:21:22 +01:00
Eladash 7e11855330 SPU/PPU LLVM: Fix FMA signed zeroes handling 2020-08-08 22:21:22 +01:00
Malcolm Jestadt f188589685 Utils: Add detection for Icelake-client tier AVX-512
- Implies support for everything that Skylake-X supports as well as AVX512IFMA, AVX512VBMI, AVX512VBMI2, AVX512VPOPCNTDQ, AVX512BITALG, AVX512VNNI, AVX512VPCLMULQDQ, AVX512GFNI, AVX512VAES
2020-08-08 00:33:22 +02:00
Megamouse 96428a7555 Log username 2020-08-07 21:57:08 +02:00
illusion d3585e1f80 move accurate rsx reservation to advanced 2020-08-07 09:34:27 +02:00
illusion c0c86521a2 add missing settings to configure 2020-08-07 09:34:27 +02:00
kd-11 22f5e7a9be vk: Generate valid image+image_view combinations for placeholder texture descriptors 2020-08-06 20:34:49 +03:00
Megamouse 06c42bba5d Qt: fixup for PKG installation 2020-08-06 17:32:29 +02:00
Bevan Weiss ada6db2df4 Replace ppu_module_manager Function Static with Class Static variable (static module map) (#8669)
* Replace ppu_module_manager Function Static with Class Static

Makes for a slightly 'cleaner' interface in my opinion, may also assist with adding thread read/write concurrency support in future if ever required (have left that out of this commit to match existing function).

Very slight performance improvements were seen in representative testing.
https://quick-bench.com/q/GMbgeNc-mZc21aqOKCofnbzPZvg

I didn't investigate whether static initialisation of the static_modules might actually be possible here, perhaps there's a way to do a constexpr / consteval of this.

* Fix up for old style cast syntax..

* Fixups from PR comments

Plus remove spurious type_traits include (from me) not picked up in previous PR

* Remove old code

* Update rpcs3/Emu/Cell/PPUModule.h

Co-authored-by: Eladash <elad3356p@gmail.com>

* Fix naming of static variable

Co-authored-by: Eladash <elad3356p@gmail.com>
2020-08-06 12:34:08 +02:00
Bevan Weiss eee5e812f7 Fix for incorrect assignment of ghlguitar
found_ghltar was potentially being overwritten if multiple USB devices were present
2020-08-06 12:01:21 +02:00
Bevan Weiss eb5ae94c24 sys_usbd tidy ups
Tidy up fake transfer iterator handling. erase invalidates all iterators including the current iterator (i.e. 'it'), given precedence ordering this was UB prior to C++17.  Splitting out to use return iterator from erase seems cleaner.
Also added some additional info to usb debug message to potentially help with #8666, and used the atomic (dev_counter) less often
2020-08-06 12:01:21 +02:00
kd-11 7109fe9889 rsx: Improve swizzled layout detection
- Reset swizzle flag to false automatically on section reset.
- Detect render target payload and extract swizzle information from it.
2020-08-05 23:23:38 +03:00
Megamouse 17557df9f4 Qt: unify package installation logic 2020-08-05 08:10:22 +02:00
Megamouse fab1f7d939 Qt: add rap files to pkg install file dialog 2020-08-05 08:10:22 +02:00
Megamouse 815d6f4223 Qt: fix input lag in pad settings
Looks like repainting stuff inside a resizeable layout is slow AF
2020-08-04 16:15:13 +02:00
Megamouse 25d73f5a70 Try to fix ugly GUIs 2020-08-03 22:03:15 +02:00
Megamouse d633a266c1 Add config override as cli arg: --config <path>
And add some more logging
2020-08-03 21:31:53 +02:00
dio-gh 938bf8624c make some cfg logs error instead of fatal
- in case there's a default value to fall back to, log with error
  instead of with a fatal
2020-08-03 20:59:47 +02:00
Megamouse 2cdb46b167 Qt: do not use on_<obj>_<action> syntax for slots
Qt tries to auto connect those
2020-08-03 20:17:35 +02:00
Megamouse 8799eebfe1 Qt: move some more settings to persistent_settings 2020-08-03 20:17:35 +02:00
Eladash 70fb5712e5 PPU interpreters: Fix VMAXFP NaN and signed zeroes handling 2020-08-03 15:43:00 +01:00
Eladash 6a51c27fde PPU LLVM: Fix VMAXFP, VMINFP NaN handling 2020-08-03 15:43:00 +01:00
Eladash 17f965c171 lv2: Minor fix of "unspecific ppu" path of _sys_lwcond_signal 2020-08-03 02:57:20 +03:00
kd-11 bd21930d1a rsx: Decode swizzled GPU data on CPU readback
- Currently this conversion is being done on the CPU to reuse as much code as possible.
  The expectation is that this almost never happens, so there is not point in increasing maintenance burden by adding compute paths
2020-08-02 16:14:11 +03:00
kd-11 4df933275b rsx: Propagate raster type of fbo sourced data throughout the pipeline.
- Tracks which kind of raster was done (Z-ordered vs linear) throughout the application.
- This allows to identify if data is in the expected format or not.
2020-08-02 16:14:11 +03:00
Megamouse 107129f95a Fix missing GPU in game window title 2020-07-31 01:13:00 +02:00
JohnHolmesII e11734f971 CI: Avoid trying to publish builds on forks 2020-07-30 23:36:10 +02:00
Megamouse 3bba9708d9 Gracefully abort headless mode with unsupported video renderers
Also fix no_return bug
2020-07-30 20:03:51 +02:00
Eladash dd497625a5 PPU LLVM: Fix constant folding of BitCast 2020-07-30 17:06:24 +01:00
Eladash f6764767f6 SPU/PPU LLVM: Fix cpu_translator::get_const_vector<v128>() 2020-07-30 17:06:24 +01:00
Eladash e52dd9dc6f SPU: Implement SYS_SPU_THREAD_OPTION_DEC_SYNC_TB_ENABLE (#8657) 2020-07-30 14:01:25 +01:00
Megamouse 03ae1481fb Don't open an error dialog in headless mode 2020-07-30 12:17:35 +02:00
Eladash 82068cf802 SPU: Fix spu_thread::cpu_stop() missed executions (#8656) 2020-07-30 10:07:18 +01:00
Megamouse ebf832214e cheat_manager: notify if no game is running 2020-07-29 13:18:33 +02:00
Megamouse 4315363f4b cheat_manager: make sure that the patches path exists 2020-07-29 13:18:33 +02:00
Megamouse f073ff8fe8 overlays: fix minor warning 2020-07-29 13:18:33 +02:00
Megamouse 47040be3ad cheat_manager: improve parser errors 2020-07-29 13:18:33 +02:00
Megamouse d0bb9d2b62 cheat_manager: move cheats.yml to patches folder 2020-07-29 13:18:33 +02:00
Megamouse cb6e536fbd cheat_manager: use enum values for columns 2020-07-29 13:18:33 +02:00
Megamouse f820a7a205 cheat_manager: disable search buttons if nothing was entered in the search field 2020-07-29 13:18:33 +02:00
Megamouse 16212854b4 cheat_manager: fix long search result lists 2020-07-29 13:18:33 +02:00
Megamouse 1c6003acd5 Improve error handling of config nodes
These conditions are most likely only gonna be met during development
2020-07-29 11:28:16 +02:00
Megamouse ef3e8d26ce Improve error handling during config loading 2020-07-29 11:28:16 +02:00
Eladash 21a1072117 SPU LLVM: Minor cleanup after #8559 2020-07-29 03:32:21 +03:00
MSuih 2ce49e3674 Improve error messages in firmware install 2020-07-28 20:55:33 +02:00
Megamouse e58e1ebfd9 Qt: fix download menu visibility 2020-07-28 20:07:21 +02:00
Bevan Weiss 609182b131 Update cellAudio to use float constants instead of doubles
Another simple Clang recommendation
2020-07-26 17:23:02 +03:00
Bevan Weiss 7898ae6fe6 VK_REMAP enum is signed.. but later case comparison is unsigned
another clang directed fix up... might be involved with swizzle..
2020-07-26 15:27:51 +03:00
Malcolm Jestadt a9d0ffcac1 SPU LLVM: Avoid additional endian swapping
- Avoid additional endian swapping with the ROTQBY and ROTQBYBI instructions
- ROTQBYI is left out intentionally, since it caused worse codegen
2020-07-26 11:36:50 +01:00
Malcolm Jestadt 824be77bba SPU LLVM: Avoid redundant endian swapping
- PSHUFB operates in reverse byte order from SHUFB, so we can take advantage of that to swap endianness without additional transformations in some situations
2020-07-26 11:36:50 +01:00
Ani 74c8a44d84 rsx: Fix cache skipping shaders on load+compile (#8633)
When on single worker mode (OpenGL or an hypothetical scenario of a 
single core PC with Vulkan), load and compile would skip 10% of the 
shaders on queue each stage.

Co-authored-by: kd-11 <karokidii@gmail.com>
2020-07-26 08:47:50 +01:00
Whatcookie 9f829b375a SPU/PPU LLVM: Optimize VSEL/SELB with constant mask (#8559) 2020-07-25 17:59:35 +01:00
Eladash da44d5f10d PPU: Fix DIVW, DIVWU, MULHW, MULLW, MULHWU when op.rc is set (#8630) 2020-07-25 17:13:58 +01:00
kd-11 be4b71b805 vk: Fixup for PR #8590
- This change was lost during rebase
2020-07-25 14:48:11 +03:00
kd-11 b0c7ca6d1f vk: Improve video memory manager to attempt recovery in out of memory situations 2020-07-25 14:48:11 +03:00
kd-11 4d8de282f9 vk: Improve typeless texture succession
- Ensure incoming texture is large enough that the original one fits inside it to avoid back-and-forth succession.
- Make use of the resource manager to remove the obsolete textures to avoid holding on to the them which "leaks" VRAM.
  The memory isn't leaking, it's just wasting space in temporary pool until renderer is closed.
2020-07-25 14:48:11 +03:00
Bevan Weiss c5d39ace2b Update types.h to fix static_cast test (#8627)
Trivial fix up to resolve invalid is_constructible test (To,To) to match desired (To,From)
2020-07-25 09:46:47 +01:00
Megamouse de80a4b6c7 overlays: try to fix unexpected font crop 2020-07-25 10:21:52 +03:00
Eladash 917069e31a PPU Precise/LLVM: Support NJ modes (#8617) 2020-07-25 07:41:41 +01:00
Eladash 3354c800d7 SPU/PPU LLVM: Improve expressions matching (#8620) 2020-07-24 16:53:48 +01:00
Megamouse bb3ac62126 cellMic: use s32 consistently 2020-07-24 14:47:10 +02:00
Megamouse 6e25fea16a use not_an_error in sys_spinlock_trylock 2020-07-24 14:47:10 +02:00
Megamouse 5e7c6853c2 fix truncation warnings 2020-07-24 14:47:10 +02:00
Megamouse f76a011ba0 fix sceNpCommerce2CreateCtx log message 2020-07-24 14:47:10 +02:00
Megamouse d854a39500 add a gazillion more error_code 2020-07-24 14:47:10 +02:00
Megamouse a00ebacef3 cellFont: add error_code 2020-07-24 14:47:10 +02:00
Megamouse c2f4244c4d cellMic: error_code, random cleanup and stubbing 2020-07-24 14:47:10 +02:00
Megamouse 7437c324c6 cellMusic: add error_code 2020-07-24 14:47:10 +02:00
Eladash 54b87b6dbb cellSaveData: Increase sleep time 2020-07-23 13:45:58 +03:00
Eladash a029a94c73 SPU: Use waitable atomics for SPU channels interface 2020-07-23 13:45:58 +03:00
illusion 3157a10428 move executable hash log level to success 2020-07-22 10:51:19 +02:00
Eladash f8d2d8ca11 SPU/Windows: Fix LS memory mirrors
This is a workaround but this is because of how utils::shm works on Windows path.
2020-07-19 17:58:49 +03:00
Eladash 0d8152cd4e SPU/Linux: Ensure aligned 64k allocations in utils::memory_reserve 2020-07-19 17:58:49 +03:00
Eladash c37bc3c55c SPU: Make spu_thread::offset private 2020-07-19 17:58:49 +03:00
Malcolm Jestadt 6cc0fe4221 SPU LLVM: Avoid negative clamping when the input is known to be positive 2020-07-19 17:56:59 +03:00
Eladash af1ceb1151 SPU LLVM: LS Memory Mirrors (Optimize loads/stores) 2020-07-18 02:01:33 +03:00
Eladash c1a80b8146 Minor fixup after #8501 2020-07-16 21:52:08 +03:00
Eladash 268bcd1c7b rsx: Fix false desync events 2020-07-16 19:26:10 +02:00
kd-11 42a9ac9e6c rsx: Brute-force removal of superseded surfaces 2020-07-16 19:11:26 +03:00
kd-11 182b20c33d rsx: Fix draw count append when draw ranges are out of order
- It is common for draw counts to truncate at 256 even when it makes no sense to do so.
- e.g 256 is not a multiple of 3 so triangles will glitch out
2020-07-14 16:04:44 +03:00
Eladash 58e2465369 Make std::bit_cast hack-implementation constexpr in simple cases 2020-07-14 12:14:44 +03:00
Eladash 07a44d0ff9 Implement constexpr byteswapping 2020-07-14 12:14:44 +03:00
Jan Beich d00f882c23 Qt/input: unbreak with Qt 5.15 after 881e8e4723
rpcs3/rpcs3qt/pad_settings_dialog.cpp:674:16: error: variable has incomplete type 'QPainterPath'
                QPainterPath path;
                             ^
/usr/local/include/qt5/QtGui/qmatrix.h:54:7: note: forward declaration of 'QPainterPath'
class QPainterPath;
      ^
2020-07-14 08:33:56 +02:00
Megamouse e70e534bfa Qt: Fix YoRHa background for some widgets 2020-07-14 02:08:15 +02:00
Megamouse d345916241 Qt: Fix Skyline's QSpinBox and QDoubleSpinBox buttons 2020-07-14 02:08:15 +02:00
Megamouse fe8bcac270 Qt/input: add tooltips to pad settings 2020-07-14 00:06:43 +02:00
illusion 60f05fdbf3 move applied patch log level to success 2020-07-13 22:33:03 +02:00
Megamouse ad0f12c742 Qt/input: add checkbox for emulated stick values 2020-07-13 21:23:48 +02:00
Megamouse 2f2a03b37b Qt/input: fix stick preview for disconnected pads 2020-07-13 21:23:48 +02:00
Megamouse 881e8e4723 Qt/input: show emulated sticks in pad settings 2020-07-13 21:23:48 +02:00
Megamouse e1af6dc4af Qt/input: add squircle to pad settings dialog 2020-07-13 21:23:48 +02:00
Megamouse 4d9533ea54 input: use left and right squircle values 2020-07-13 21:23:48 +02:00
Eladash d6623e0f22 RSX debugger: fix command count on non-method commands (#8578)
* RSX debugger: fix command count on non-method commands

* fixup

* constants and variables
2020-07-12 12:40:47 +02:00
kd-11 ab3d36f0f3 rsx: Fix depth bounds test
- Allow depth bounds test to access the Z buffer even when depth test is disabled.
2020-07-10 15:59:15 +03:00
kd-11 632af8d723 rsx: Support partial texture descriptors
- It is safe to declare w > pitch and it works as long as sampling inside the legal 2D area is obeyed.
2020-07-10 15:26:07 +03:00
Eladash 282b00674a SPU LLVM: Optimize non-constant Tag Update requests 2020-07-10 02:52:02 +03:00
Eladash 235d12aa6b SPU MFC: Never clear tag status in WrTagUpdate 2020-07-10 02:52:02 +03:00
Eladash 5d1fc546a8 SPU MFC: Fix MFC_WrTagUpdate channel count
Always report available, in realhw this is just a hint if the previous tag update hasnt been checked yet by the MFC, avoiding blocking writes and allowing the SPU to execute some code while it processes the previous update request.
Except for MFC_TAG_UPDATE_IMMEDIATE, where it also waits for MFC to process it.
2020-07-10 02:52:02 +03:00
Eladash eb993781ef RawSPU: Log MMIO access 2020-07-09 23:24:47 +03:00
Megamouse 0756fd9c7e Qt: fix pad settings resize when switching tabs 2020-07-09 08:20:37 +02:00
Megamouse a3e79fc105 Qt: fix scrollArea focus during pad button choice
Assigning arrow keys was broken because of this
2020-07-09 08:20:37 +02:00
Eladash 84470c34db SPU: Disable PUTLLC NOP transfers detection on TSX path 2020-07-09 03:17:35 +01:00
Eladash f8dbfa1d1e SPU: Implement GETLLAR polling detection 2020-07-09 03:17:35 +01:00
Eladash d9750e8f9f SPU/PPU reservations: Optimizations for reservation locks and check_state() (non-TSX) 2020-07-09 03:17:35 +01:00
Megamouse e09c4b72c8 Qt: fix update menu for linux 2020-07-08 22:21:27 +02:00
Megamouse 53b95fea19 audio: rename audio channels to audio downmix
The setting does not actually define the channels themselves, only the downmix option that the PS3 provides.
Channels might be changed seperately in the future.
2020-07-08 21:11:23 +02:00
Megamouse e2fd4e46f7 Only reboot audio if a relevant setting changed 2020-07-08 21:11:23 +02:00
Megamouse 20d6664dc1 Try to make most audio configs dynamic 2020-07-08 21:11:23 +02:00
Megamouse 8ee953ef8e XAudio2: Call CoInitializeEx to prevent errors
I could not properly reset the audio backend and call CreateMasteringVoice without getting errors
2020-07-08 21:11:23 +02:00
Megamouse 5b7ee43352 XAudio2: print readable errors 2020-07-08 21:11:23 +02:00
Megamouse 8add57f8e9 VS: show linux audio backends in solution explorer 2020-07-08 21:11:23 +02:00
Megamouse bb0aaea92d cellAudio: implement downmix to 5.1 2020-07-08 21:11:23 +02:00
kd-11 987ede2e6c vk: Inject memory barrier upon conclusion of a framebuffer feedback loop
- Do not write to the texture until previous draw call is completed using it.
- This is usually not much of a problem until blending operations come into play.
2020-07-08 19:23:29 +03:00
Megamouse 5fae1b3637 HLE: fix sceNpDrmGetTimelimit invalid param error 2020-07-07 09:43:32 +02:00
Derrik Touve cb08c53f2f sys_net: Use np_handler dns if possible for sys_net_infoctl (#8557)
Without this, cellHttpSendRequest will use the hardcoded dns 192.168.1.1, which won't work if you're not on that network.
2020-07-07 08:25:29 +02:00
Megamouse 171e4fafed Emu: simplify Emu::Stop some more 2020-07-06 21:14:16 +02:00
Megamouse 8d2ce2815c Emu: Make prevent_display_sleep dynamic 2020-07-06 21:14:16 +02:00
Megamouse d91551c277 Emu: always use Emu.Quit() to quit RPCS3
This creates a single possible point of failure for calling quit()
2020-07-06 21:14:16 +02:00
Megamouse 332f9cae77 Qt: Remove obsolete main window close()
The gui settings aren't part of the main window anymore
2020-07-06 21:14:16 +02:00
Eladash dc25a3fa2a PPU debugger: Show stack address of each function 2020-07-06 18:58:16 +02:00
Eladash c98ec4d014 PPU debugger: Fix functions stack bounds check 2020-07-06 18:58:16 +02:00
kd-11 05dc6ad610 gl: Silence warnings 2020-07-05 16:58:44 +03:00
kd-11 3fe8499956 rsx: Improve ZCULL queued requests finalization
- Unifies the code
- Allows conditionals to be evaluated with a forwarder present
2020-07-05 16:58:44 +03:00
Megamouse f1b1c9053c Input/Qt: Check if gui callbacks are nullptr 2020-07-04 14:28:19 +02:00
Megamouse ea4cc0b395 Qt: use button box for most buttons 2020-07-04 14:28:19 +02:00
Megamouse be8980fc23 Qt: add scrollarea to pad settings dialog 2020-07-04 14:28:19 +02:00
Megamouse e4a9c177e6 Qt: Random unimportant stuff 2020-07-04 14:28:19 +02:00
Megamouse 99be645fcc Qt: Add stick multipliers to the pad dialog 2020-07-04 14:28:19 +02:00
Megamouse f8920edb2e patch_manager: save "owned games only" state 2020-07-03 18:09:06 +02:00
kd-11 acf51f0ead rsx: Fix transfer descriptors for partially overlapping slices in head
- Height must be corrected to skip the piece that exists before the current slice
2020-07-03 14:29:54 +03:00
Megamouse ddd202b5ff Qt: fix signal_update_available
m_update_message has to be non empty
2020-07-03 00:21:58 +02:00
Megamouse 78eb7e73bc Qt: remove automatic param from update logic
At that point we already had user interaction, so there is no point in hiding the error dialogs
2020-07-03 00:21:58 +02:00
Eladash 72337f2678 SPU LLVM: Fix barrier commands enqueuing 2020-07-02 22:46:02 +03:00
Megamouse 14200c1a1f Qt: refactor curl stuff into a downloader
And add 'Background' updater
2020-07-02 20:22:58 +02:00
Megamouse c495ef10b0 Qt: fix random QWinTaskbarProgress crashes 2020-07-02 20:22:58 +02:00
Megamouse 3bdce6050b Qt: random cleanups 2020-07-02 20:22:58 +02:00
kd-11 c9c0d7361d rsx: Implement fast ZCULL barrier when query object is already known 2020-07-02 20:11:57 +03:00
kd-11 d7ffc8b4ac rsx: Fix leaking ZCULL queries after a barrier
- Multiple queries can be queued up, process them all before completing the barrier
2020-07-02 20:11:57 +03:00
Megamouse b5f01372ee Windows: distinguish left and right modifiers
This is just some workaround until we either use a different input api for keyboards or until we refactor the keyboard_pad_handler to use Qt with native scan codes
2020-07-02 12:55:27 +02:00
Megamouse bec6bde919 Qt/Input: update keyboard_pad_handler shortcuts
This is just some patchwork before the shortcuts get refactored eventually
2020-07-02 12:55:27 +02:00
Megamouse 1f25924384 Qt/Input: remove unused function: GetModifierCode 2020-07-02 12:55:27 +02:00
Jacques Yakoub 36cf5dca82 localized.h: follow Sony Naming Conventions (#8539)
* localized.h: follow Sony Naming Conventions

See this : https://github.com/RPCS3/rpcs3/issues/4259 (Main Window -> (Localized) Replace the category names with either something more gramatically correct or something used in Sony Naming Conventions)
2020-07-02 09:39:10 +02:00
Bird Egop eea12bad07 Implement Caret upwards and downwards move in overlay_edit_text (#8342)
* Implement caret upwards and downwards move in overlay_edit_text

* Optimize caret up and down movement

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-07-02 09:06:37 +02:00
Ani 6a9fe8e3c4 rpcs3_version: Bump to 0.0.11 2020-06-30 22:35:17 +01:00
Megamouse 55e907385b patch_manager: warning for incompatible patches (#8535)
* patch_manager: warning for incompatible patches

This will open a warning dialog whenever the patch manager is opened and incompatible patches are detected.

* Apply suggestions from code review

Co-authored-by: Bird Egop <sampletext32@bk.ru>

Co-authored-by: Bird Egop <sampletext32@bk.ru>
2020-06-30 21:35:15 +02:00
kd-11 bd14429f20 vk: Disable primitive restart for old GCN cards
- Also adds more Navi 14 chips to detection table
2020-06-30 15:00:07 +03:00
Megamouse 5867b3b72e patch_manager: fix items across refreshs 2020-06-30 03:04:35 +02:00
Megamouse 45e1a8756f patch_manager: fix import dialog close button 2020-06-30 03:04:35 +02:00
Megamouse 6742fad753 patch_manager: fix import, use constants as keys
And improve import logging again
2020-06-30 00:45:17 +02:00
Megamouse c6190fa95d patch_manager: improve import logging
imported_patch.yml has to be the latest version too
2020-06-29 23:56:27 +02:00
Megamouse 372eff2d8f patch_manager: fix sorting of item counters >= 10
This only deals with less than 100 items (that amount is undesirable in the first place)
2020-06-29 23:56:27 +02:00
Megamouse 98eb0cd3f2 patch_manager: fix legacy patches again 2020-06-29 23:56:27 +02:00
Megamouse 541e20cbec patch_manager: allow Notes as sequence 2020-06-29 23:56:27 +02:00
Megamouse ef203f6bcb patch_manager: fix owned games o. for all versions 2020-06-29 23:56:27 +02:00
Megamouse a5368d766a patch_manager: prefer specific > global (per hash) 2020-06-29 23:56:27 +02:00
Megamouse cf2e2a0511 patch_manager: one patch per group across hashes 2020-06-29 23:56:27 +02:00
Megamouse e5bb5f02e0 patch_manager: Always move All titles to the top 2020-06-29 23:56:27 +02:00
Megamouse 3a17eefde7 patch_manager: restrict All serials to All titles 2020-06-29 23:56:27 +02:00
Megamouse 7d2ecbf29a patch_manager: don't hide "All Serials" in 'owned' 2020-06-29 23:56:27 +02:00
Megamouse c72a6f8e6f patch_manager: prefer serial patches over All 2020-06-29 23:56:27 +02:00
Megamouse 6a486d3402 patch_manager: only apply one patch per group
So far this was purely handled in the GUI
2020-06-29 23:56:27 +02:00
Megamouse e43db24b2c patch_manager: add All override
All can now be used as a key for title, serial and/or app version.
If you check a patch for all ... then the patch will be applied regardless of what's checked for the game specifically, because we do not save 'Unchecked' patches.
2020-06-29 23:56:27 +02:00
Megamouse 3ea33763bc patch_manager: add expand and collapse
Also reorder the context menu and remove some options if not applicable
2020-06-29 23:56:27 +02:00
Megamouse 695cfead16 patch_manager: add option to only show owned games
and remove the app version level from the gui
2020-06-29 23:56:27 +02:00
Megamouse 12dded403f patch_manager: implement serials and app_versions 2020-06-29 23:56:27 +02:00
Eladash a7a5034958 remove redundent include in Crypto/unedat.cpp (#8527) 2020-06-29 18:03:38 +01:00
Megamouse fa81146b79 Use proper install paths depending on pkg content 2020-06-29 10:36:24 +02:00
Megamouse 5269b69bc5 cellAudio: use downmix formula based on documentation 2020-06-29 09:06:36 +02:00
Eladash d9e3f0ccfa types.h: Fix ASSUME macro side-effects mismatch between compilers 2020-06-29 03:10:05 +01:00
Eladash 2483cc6f8d Fix race in Crypto/unedat.cpp, Make NPDRM keys usage atomic 2020-06-28 23:26:10 +01:00
Eladash 97717defa5 Remove devKlic/rifKey reset 2020-06-28 23:26:10 +01:00
kd-11 5e29bdbe22 vk: Add more GPUs to nvidia chip table
- Registers more TU116 and TU117 variants
- Registers GA100
2020-06-28 22:54:58 +03:00
kd-11 b437794e92 vk: Improve nvidia speedhack for non-turing cards
- Inverts the chip family check to skip any unidentified GPUs altogether
2020-06-28 22:54:58 +03:00
Eladash 9fcbad326a debugger: Fix registers editor 2020-06-28 11:51:24 +02:00
Eladash 2c93fecd8b SPU: Use named constants for MFC tag updates 2020-06-27 20:42:41 +01:00
Eladash 20fcc6530f SPU LLVM: Fix WRCH instruction to WrTagUpd 2020-06-27 20:42:41 +01:00
illusion 11e75853a6 ui: add rsx some options to gui (#8512)
disable hw fp16 to advanced
3d tv support to gpu
2020-06-27 19:19:35 +01:00
Eladash 9cb4402c16 Make error_code::value member private 2020-06-27 09:02:55 +01:00
Eladash f29589e5cf SPU debugger: Add atomic status and tag update channels information 2020-06-27 07:04:37 +01:00
Eladash d7842b7de2 SPU LLVM: Fix WRCH instruction to WrTagMask 2020-06-27 07:04:37 +01:00
Megamouse 5a8eb9d3d7 Input: skip keyboard input when pads are disabled 2020-06-26 09:28:58 +02:00
Megamouse ab4c40c988 pad_thread facepalm 2020-06-26 09:28:58 +02:00
kd-11 5ea6535fd5 rsx: Force flushing of NaN/INF to zero
- This option was always enabled for NVIDIA cards, but it seems some games would benefit from the option on other GPUs as well.
- TODO: Hwtest to verify correct behavior and plan how to safely implement in hw
2020-06-26 09:24:15 +03:00
Megamouse 76faaf43f7 Input: Use global variables for pad modifications 2020-06-26 04:42:52 +02:00
Megamouse 9679ae68cb patch_manager: more information for branch nodes 2020-06-25 22:14:18 +02:00
Megamouse 7d3389d548 patch_manager: save widget layout 2020-06-25 20:49:57 +02:00
Eladash ab9cdc70ad cellSaveData: Emulate PPU processing of auto/list post-fixed callback 2020-06-25 19:50:33 +03:00
Eladash e45d37073a debugger: Shortend SPU/PPU thread names 2020-06-24 17:44:06 +02:00
JohnHolmesII e353ad3557 Update BUILDING.md
Change Qt version to reflect the fact that nothing older or newer than 5.14.2 will build. Sad times.
2020-06-24 16:10:26 +02:00
Megamouse abec850379 patch_manager: add hash to applied log message 2020-06-24 15:31:55 +02:00
Megamouse 431e0eb30c patch_manager: fix missing config path 2020-06-24 15:31:55 +02:00
kd-11 628cb1c779 rsx: Validate blend factors according to hardware testing 2020-06-23 12:15:02 +03:00
kd-11 a14e0a0104 rsx: Validate stencil op to match realhw behavior 2020-06-23 12:15:02 +03:00
kd-11 f3637cdfdb rsx: Fix surface options hint mechanism
- Silly typo
2020-06-23 12:15:02 +03:00
kd-11 c6a9a5d5d7 rsx/fixup: Fix color clear logic
- Enable fast clears on ABGR formats in vulkan
- Fix disabling color clears for unsupported formats in GL
2020-06-23 12:15:02 +03:00
Megamouse 7e3ece7d9f Update readme badges 2020-06-23 03:34:36 +02:00
kd-11 7f917c8ba5 rsx: Fix ABGR decoding for colormask and clear color
- The bytes in these values are based on the format according to hw tests
- G8B8 is unaffected as the first two bytes are already G8B8 for A8R8G8B8 standard layout (BGRA)
- A8B8G8R8 and its derivatives have words 0 and 2 exchanged.
2020-06-22 20:12:41 +03:00
kd-11 e992cbe01b rsx: Support DRGB8 sampling of render targets 2020-06-22 20:12:41 +03:00
Megamouse 1974911a71 patch manager: Skip legacy patch.yml in the GUI
The legacy patches aren't supposed to be shown in the GUI anyway.
2020-06-21 15:48:30 +02:00
Megamouse 8659994b2c patch manager: Fix load order 2020-06-21 15:48:30 +02:00
Megamouse 5affc459a2 patch manager: Allow partial patch file import 2020-06-21 15:48:30 +02:00
Megamouse cd4ed11700 patch manager: Add patch removal to context menu
Also avoid saving empty patch maps
2020-06-21 15:48:30 +02:00
Megamouse c4fe418f66 patch manager: fix tree refresh and item expansion 2020-06-21 15:48:30 +02:00
Megamouse 7d9d58f38f patch manager: Properly hide legacy patches 2020-06-21 15:48:30 +02:00
Megamouse b212f29cf2 patch manager: "Show Patch File" in context menu 2020-06-21 15:48:30 +02:00
Megamouse fd2cd84555 patch manager: Skip lower patch_versions 2020-06-21 15:48:30 +02:00
Megamouse bf978ac8ca patch manager: properly check patch versions
Also abort patch import of lower patch versions
2020-06-21 15:48:30 +02:00
Megamouse d3c6472c0f patch manager: replace Version and Title keys
With Patch Version and Game Title
2020-06-21 15:48:30 +02:00
Megamouse 1c7a318413 patch manager: move try catch block to yaml.cpp 2020-06-21 15:48:30 +02:00
Megamouse 591624b96c patch manager: avoid patch import inconsistencies
Save the original patch value instead of the interpreted value
2020-06-21 15:48:30 +02:00
Megamouse 2323cd2a2d patch manager: move title + serials to patch level
Also bump patch file version to 1.1
2020-06-21 15:48:30 +02:00
Megamouse cc5c89539b patch manager: improve error handling
There shouldn't be much left that can crash this thing
2020-06-21 15:48:30 +02:00
Megamouse a7ee059419 patch manager: import patches 2020-06-21 15:48:30 +02:00
xperia64 7d5c8fe553 Change DLL permissions so Windows clients which respect permissions set them correctly (#8470) 2020-06-20 21:44:38 +01:00
Megamouse fd048a75da Qt: Improve update manager messages
- Add restart hint to success message
- Use days to measure time greater than 24 hours
2020-06-20 17:12:45 +02:00
Oschowa 5c1ce6350b FAudio: remove 4x volume factor
Same as commit 66d13da2ac for the XAudio2 backend
2020-06-20 12:42:56 +02:00
Eladash d86c9a2549 sys_mmapper: rewrite page fault thread notifications
* Fix a corner case where SPU thread has the same ID as a PPU thread.
* Fix a potential deadlock on Emu.Stop() while sending event in EBUSY loop.
* Thread specific notifications.
2020-06-18 20:13:54 +03:00
sampletext32 249686708c Update Github Issue Template: Regression 2020-06-18 06:49:59 +03:00
Eladash 3ee1d8aed1 fixup 2020-06-18 06:47:07 +03:00
Eladash 5c6dae498b SPU LLVM: Avoid bad optimization in FCGT 2020-06-18 06:47:07 +03:00
kd-11 2086e7f2e8 rsx: Account for subpixel precision when converting DST coordinates to
SRC coordinates

- When extracting a 1x1 texture from another texture of a different
  format, width conversion can result in a dimension of 0 if the
extracted texel is not a full texel in SRC
2020-06-17 22:18:47 +03:00
sampletext32 4092e3e95f Update Github Issue Template: Bug 2020-06-17 15:46:33 +03:00
kd-11 c764925b4d rsx: Properly handle conversion of G8B8 and related formats
- These formats are 16-bit packed, not separate 8-bit channels. Conversion requires byteswap for them.
2020-06-16 22:36:38 +03:00
kd-11 83d818d96f rsx: Improve mipmap gathering
- Account for source offsets when grabbing subregions
- Scale input accordingly when sourcing from fbo in all paths
2020-06-16 19:12:03 +03:00
RipleyTom 3d3c91d654 std header guard in BEType.h (#8448) 2020-06-16 01:06:15 +01:00
sampletext32 0ad4e91001 Avoid string reallocation in swizzle CgBinaryProgram 2020-06-15 22:26:49 +03:00
Eladash 731d4330fe v128: A few optimizations (#8432) 2020-06-15 17:24:04 +03:00
Eladash 5777a1d426 SPU: Implement EBUSY error on non-empty mailbox (sys_spu_thread_send_event/sys_event_flag_set_bit)
Write into inbound mailbox under mutex.
2020-06-15 17:08:57 +03:00
Eladash 5fda9a4efb sus_lwcond_signal_all: use protocol specified in lwmutex
Trying to fix a nearly impossible corner case.
2020-06-15 17:08:57 +03:00
Eladash c15b5f1eca SPU: Move check_state() outside of mutex scope
Can result in a deadlock in some cases, cpu flags are checked after this function as well anyways.
2020-06-15 17:08:57 +03:00
Eladash 314dc4c5de sys_cond: Fix spurious EBUSY in sys_cond_destroy
Increment waiters count inside IDM's mutex lock scope.
2020-06-15 17:08:57 +03:00
Eladash a0f0f58fc5 sys_event_queue: Fix IPC support 2020-06-15 17:08:57 +03:00
Eladash 92b7c56f29 sys_cond/mutex: Fix race between sys_cond_create and sys_mutex, Fix IPC support in sys_cond/mutex 2020-06-15 17:08:57 +03:00
kd-11 8d8fb4a2e4 rsx: Remove ARGB->D24S8 conversion shader which has been deprecated for years since compute capabilities were added to the emulator 2020-06-15 14:18:12 +03:00
sampletext32 717e851a99 Create Github Issue Template: Feature Request 2020-06-15 00:46:48 +03:00
kd-11 2e737ad483 rsx: Fix surface option invalidation
- Depth buffers can be in special "read" state when writes are disabled. Account for this.
2020-06-14 23:30:03 +03:00
Eladash 88a0e0fe2d cellAudio: Minor fixup 2020-06-14 18:45:46 +01:00
Eladash e2248332ae rsx: Make "Disable ZCull Occlusion" setting dynamic 2020-06-14 18:45:46 +01:00
kd-11 3663a8ab4d rsx: Improve surface options invalidation 2020-06-14 20:13:12 +03:00
Eladash 5430892052 sys_vm: Limit total process vsize to 256MB (#8431) 2020-06-14 15:27:34 +01:00
Eladash ff04cd6d69 cellAudio: Fix event queue attachment 2020-06-14 02:31:23 +03:00
Eladash aa4fdff82c Fix lv2_obj::name64 regression 2020-06-14 02:25:29 +03:00
Eladash 5bc4f9df0d debugger: Always show zeroes on no thread's instructions positions 2020-06-14 02:08:04 +03:00
Eladash 5d0066029f debugger: Fix instructions foreground/background color changes on non-executable memory 2020-06-14 02:08:04 +03:00
Eladash 56962a58da Fix debugger breakpoints 2020-06-14 02:08:04 +03:00
Malcolm Jestadt 746615a937 Fix embedded spu elf patching 2020-06-13 23:18:44 +02:00
Nekotekina e485c9c79c Atomically overwrite config.yml
Protection against data corruption.
2020-06-12 22:41:50 +03:00
Eladash bd6fdf3f2d rsx: Optimize rsx::rsx_iomap_table construction 2020-06-12 22:40:58 +03:00
Eladash e1f8573c68 sys_net: Fix sys_net_bnet_setsockopt page faults 2020-06-12 22:39:13 +03:00
Eladash 4bc157881d sys_net: Stub sys_net_infoctl command 9 2020-06-12 22:39:13 +03:00
Eladash f0d526411c IDM: Implement idm::clear<typename> 2020-06-12 22:12:36 +03:00
kd-11 e1183f6919 gl: Fix depth buffer byteswap hint
- uint24_8 is not actually swapped, it is decoded in a special way
2020-06-12 20:49:47 +03:00
kd-11 f4ec28d932 rsx: Merge instruction expand flag with the other sign expand flags
- Avoids double expansion when both the exp_tex flag is set AND the texture also is sampled as signed
- Should fix missing eyeballs in Mass Effect 1 with the previous sign expansion fix
2020-06-12 20:19:20 +03:00
kd-11 ce587f43a0 rsx: Implement signed normalized texture formats
- Already partially supported via EXP option in the shader opcode, but format decoding was disabled.
- Noticed in some UE3 games which use _SNORM variants on PC but _UNORM on rpcs3
2020-06-12 20:19:20 +03:00
Eladash 6892399699 kernel_explorer: More Improvements 2020-06-12 09:28:23 +02:00
Megamouse 22b1cc765a patch manager: hotfix for legacy patches
Assignment of invalid YAML nodes is not possible after all
2020-06-11 22:23:02 +02:00
Eladash b9cb181691 sys_memory: Improve allocation/deallocation syscalls 2020-06-11 20:03:32 +03:00
Megamouse 4a03f06175 patch manager: add checkbox for "enable legacy" 2020-06-11 16:31:49 +02:00
Ilya 768bb8d31f Workaround broken Azure badge link
Looks like Azure has broken API a bit, so link to the full list of the latest builds in the meantime
2020-06-11 14:08:11 +02:00
Eladash 0bf8f2a527 PPU interpreters: Fix VRFIM, VRFIN, VRFIP, VRFIZ 2020-06-11 14:31:38 +03:00
Megamouse 2dca8d84e1 patch manager 2020-06-11 13:15:25 +02:00
JohnHolmesII 1668900fb8 Update Azure config to fix Windows Azure build (#8399)
Co-authored-by: Eladash <elad3356p@gmail.com>
2020-06-11 04:14:09 +01:00
Megamouse 66f1cbfb34 kernel_explorer: keep existing trees expanded 2020-06-09 16:48:20 +02:00
sampletext32 b75af69cf9 Improve tooltips 2020-06-08 05:51:52 +03:00
Eladash c36c425fb9 kernel explorer: Improvements 2020-06-08 05:46:36 +03:00
sampletext32 f75b26d1c9 Unify Azure artifacts names and produce them only on successful build. 2020-06-08 05:38:39 +03:00
Nekotekina bfee541540 Atomically overwrite games.yml
Reduce chances of losing information.
2020-06-07 22:44:07 +03:00
Nekotekina 3d7c38ff9d Remove lambda in sys_net_bnet_poll 2020-06-07 22:44:07 +03:00
Nekotekina 5d27f1c732 PPU: implement VNMSUBFP (precise variant) 2020-06-07 22:44:07 +03:00
Nekotekina 3b8e7d0967 Implement v128::fma32f 2020-06-07 22:44:07 +03:00
kd-11 ebbf329b6a gl: Improve async compiler synchronization with initialization
- On multithreaded mesa, the program initialization routine was not
  being flushed correctly. Set up synchronization fence after initialization
is complete.
2020-06-07 12:54:34 +03:00
kd-11 87cc937d4e rsx/fp: Separate SRC precision modifiers
- SRC0, SRC1 and SRC2 have different bits for precision modifiers all stored inside SRC1
- This explains the strange observed behavior of the MAD instruction which has 3 inputs
2020-06-07 12:07:27 +03:00
Malcolm Jestadt dcf5c06d6d SPU LLVM: Optimize FM when op.ra == op.rb 2020-06-06 22:27:48 +03:00
Malcolm Jestadt 8357523ec0 SPU LLVM: Additional FCGT optimizations 2020-06-06 22:27:48 +03:00
Malcolm Jestadt 39149fd84d SPU LLVM: Partial revert for FM/FMA changes and other improvements
- Revert changes to FM and FMA instructions
- Allow non accurate/approx FMA family instructions to use native FMA
- Minor optimization for FMA ops with a constant 0 multiply
2020-06-06 22:27:48 +03:00
Malcolm Jestadt 289c594187 SPU LLVM: Fix theoretical issue with FCGT optimizations 2020-06-06 22:27:48 +03:00
kd-11 d47d597b34 vk: Make the depth-convert pass multisample aware 2020-06-05 17:19:24 +03:00
kd-11 69c2150fbd vk: Fix query reset when renderpass is active
- Performs delayed query reset on-demand
2020-06-05 17:19:24 +03:00
Bird Egop 334d0bbc86 Add Cirrus CI FreeBSD badge (#8350) 2020-06-05 01:45:21 +01:00
Megamouse 1cb4fb9c50 stub cellPngEnc 2020-06-04 23:13:40 +03:00
Megamouse 413f87b737 Add error_code to cellPngDec 2020-06-04 23:13:40 +03:00
Megamouse 8a8edb1b62 stub sceNpCommerce2 2020-06-04 23:13:40 +03:00
Megamouse caa1324457 stub sceNpTus 2020-06-04 23:13:40 +03:00
ibrakap 776c2ada6a Remove mentionbot config 2020-06-04 23:10:54 +03:00
Megamouse 41eb6d4461 cellAudio improvements
- use CELL_AUDIO_BLOCK_32 where possible
- use CELL_AUDIO_BLOCK_SAMPLES where possible
- remove redundant logging
- return CELL_AUDIO_ERROR_AUDIOSYSTEM in cellAudioGetPortConfig (probably unreachable code anyway)
- return CELL_AUDIO_ERROR_PORT_OPEN in cellAudioPortOpen
- stub cellAudioSetPersonalDevice cellAudioUnsetPersonalDevice and cellAudioMiscSetAccessoryVolume
2020-06-04 23:09:47 +03:00
illusion 0315781306 Audio dumper: append filename with titleid and date-time
prevents overwrite of old file

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-06-04 20:10:56 +03:00
sampletext32 437f374bae Fix some checks 2020-06-04 19:48:08 +03:00
Ani 9657b3f1d4 Fix sys_net_bnet_poll regression (#8337)
Co-authored-by: Eladash <elad3356p@gmail.com>
2020-06-04 17:30:11 +01:00
kd-11 650152e05f rsx: Fix fragment state updates
- Fix copypasta for POLYGON_STIPPLE_PATTERN vs SET_POLYGON_STIPPLE method binding
- Use proper enums for ROP_control bits to avoid confusion
2020-06-03 22:05:33 +03:00
kd-11 73fe9b51de rsx/fp: Ignore self-referencing register writes.
- Sometimes, usually with shaders that do pack/unpack operations, there is a write-to-self operation.
  For example r0.xy = r0.xy
  Obviously no new data was introduced into "r0" by this, so we should not mark the register as having new data.

- TODO: Investigate on realhw if self-reference is needed to "cast" the overlapping half registers to their full register counterparts.
2020-06-03 09:45:02 +03:00
kd-11 26b2e4253d rsx: Properly account for memory sizes of reused surfaces 2020-06-02 21:37:57 +03:00
kd-11 b353bf6c56 rsx: Improve surface cache resource management
- Do not allocate too many objects. This is a problem in games using dynamic memory allocators that can make it rare for a surface to fall on the same address twice, keeping zombie RTVs and DSVs alive much longer than needed.
- Current limit used is 256M of virtual VRAM which is impossible on retail PS3
2020-06-01 22:24:27 +03:00
Malcolm Jestadt c601374b1f SPU LLVM: Use clamping helpers for FMA32x4 and FM 2020-06-01 21:39:28 +03:00
Megamouse 66d13da2ac XAudio2: remove nasty 4x volume factor 2020-06-01 19:05:48 +03:00
Nekotekina 938ca90a02 Improve Stop Watchdog
Prevent termination if PPU LLVM compilation is in progress.
2020-06-01 02:27:33 +03:00
Nekotekina 2d2ed7efd0 Add game patch support in 'Create PPU Caches'
Try to compile patched version of EBOOT.BIN
2020-05-31 23:06:54 +03:00
Nekotekina 1507a59786 SPU LLVM: fix spu_cache dependency
Should fix possible crash on exit.
2020-05-31 21:54:04 +03:00
Eladash 675fde69aa Avoid copying std::shared_ptr in sys_semaphore 2020-05-31 21:02:52 +03:00
Megamouse 99895471ae cellAudio: make master volume dynamic 2020-05-31 07:37:59 +02:00
Megamouse 3e2aede85c VS: randomly changed project files 2020-05-31 07:37:59 +02:00
Nekotekina 377ad9887c Compile EBOOT.BIN on 'Create PPU Caches' 2020-05-31 02:26:40 +03:00
kd-11 c9a978a03e Typo fix
Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-05-30 14:47:10 +03:00
kd-11 59d44cd1cc gl: Fix shader logging 2020-05-30 14:47:10 +03:00
kd-11 542a6aed51 rsx: Add stippled rendering support to interpreters 2020-05-30 14:47:10 +03:00
kd-11 1677618c75 rsx: Implement stippled rendering 2020-05-30 14:47:10 +03:00
Eladash 3df83e03a9 SPU: Fix possible deadlock after access violation via DMA transfers 2020-05-28 23:23:11 +03:00
Eladash a199c71a55 SPU: Fix page faults notifications (non-TSX) 2020-05-28 23:23:11 +03:00
Eladash 3d20ce70f5 rsx: Fix possible case NULL zcull_ctrl in on_exit() 2020-05-28 11:56:02 +02:00
Eladash f0cdd8ace6 PPU: Implement PPU Traps Stubbing option 2020-05-27 22:39:29 +03:00
Nekotekina 8e9d2fa70e SPU LLVM: implement get_segment_base()
Fake function used to compute 32-bit offset of local functions.
2020-05-27 18:53:09 +03:00
Nekotekina abf9a08ee3 Fix warnings 2020-05-27 18:41:17 +03:00
ZeeWanderer 9d02231074 [CI, Cache] Add proper cache versioning (#8285) 2020-05-26 00:33:59 +01:00
xddxd f56b362769 rsx: Copypasta fix (#8289) 2020-05-25 20:07:11 +01:00
Eladash 865180e63e sys_mmapper: Fix possible memory leak on error of create_lv2_shm 2020-05-24 19:24:07 +03:00
Eladash 3265772ae4 idm: Implement creation/destruction invalidation counter
* "Ensures" newely created IDs won't have the same ID as old destroyed objects for lv2_obj. (256 tries cycle)

Similar to how the kernel implements it.
2020-05-24 19:24:07 +03:00
kd-11 224a0e4b1a rsx: Fix data format remapping
- Includes missing 0xEE and 0x44 variants of the 2-component data format remapper
2020-05-24 13:51:19 +03:00
kd-11 bd41a108d8 nv3089: Account for subpixel addressing
- Those strange offsets noted in some games seem to match to subpixel addressing.
  For example, when scaling down by a factor of 4, a pixel offset of 2 will end up inside pixel 0 of the output
2020-05-24 11:31:37 +03:00
ZeeWanderer 695b6e8f46 [MSVC 16.6] Microsoft.MakeFile.Targets(46,5) :thisisfine: (#8279) 2020-05-23 14:53:49 +01:00
Maxim Kulyk ab6942d974 [CI, sh, Windows] Do shallow submodule init. History is not needed. 2020-05-23 11:52:17 +01:00
Maxim Kulyk 6efc735728 [CI, Windows] build SPIRV-Tools separately 2020-05-23 11:52:17 +01:00
Jan Beich 3048bb1a75 Add FreeBSD to CI (#8261)
* CI: add FreeBSD job

* CI: add FreeBSD job on CirrusCI

* CI: disable Travis on FreeBSD due to broken ccache
2020-05-23 00:54:28 +03:00
Eladash b8f86eb78d SPU: Fix page faults notifications 2020-05-23 00:48:28 +03:00
Mrlinkwii 68bee397eb Update cellSpurs.h 2020-05-22 22:19:04 +03:00
Eladash a703f6febb kernel explorer: Add information about first PRX/overlay segment 2020-05-22 17:37:22 +03:00
Eladash 81749f4353 SPU/PPU disasm: replace unknown instructions message with question marks 2020-05-22 17:37:22 +03:00
Eladash 2d1d36678d SPU/PPU disasm: replace "illegal address" with question marks 2020-05-22 17:37:22 +03:00
Eladash 0e6abd66ca PPU disasm: do not disassmble non-executable memory 2020-05-22 17:37:22 +03:00
kd-11 7080305d82 vk: Implement masked stencil buffer clears
- Partial stencil buffer clears were not implemented. This is for example where a game can choose to clear only some bits from the stencil buffer.
- Vulkan does not support masked stencil clears natively, it has to be implemented as a graphics operation.
- Also refactors vulkan overlay passes to use global resource system instead of forcing the render backend to own all of them and manage lifetimes.
2020-05-21 19:27:23 +03:00
Eladash 7c3166a0c6 SPU MFC: Fix MFC_WrListStallAck on interpreters 2020-05-20 22:55:30 +03:00
Eladash 4405f46aec SPU MFC: Fix SN interrupts 2020-05-20 22:55:30 +03:00
Eladash 81684919f5 SPU MFC: Implement MFC_SDCRZ_CMD 2020-05-20 22:55:30 +03:00
sampletext32 1a8fb61373 Fix some misspells
Note: in main.cpp there are many dirs similar to Program Files, so tip should be appropriate.
2020-05-20 22:53:24 +03:00
Malcolm Jestadt c47d04fd2f SPU: Optimize FCGT
- Optimize FCGT to a single signed integer comparison when possible
- Add is_spu_float_zero helper
2020-05-20 21:55:01 +03:00
ZeeWanderer 91ee480e56 [msbuild] only link llvm libs to Applications (#8262)
Previously llvm libs were linked into all lib pjojects that import `rpcs3_llvm.props` which resulted in 200+ MB libs and probably longer compile time.
2020-05-20 07:40:14 +01:00
sampletext32 3d320aea2c Optimize Qt properties in about_dialog
https://doc.qt.io/qt-5/qt.html#TextInteractionFlag-enum
2020-05-19 08:18:21 +02:00
Megamouse 703841e251 Qt: disable TSX in the config.yml if not supported 2020-05-18 17:46:31 +02:00
Megamouse 1fffffad7a Qt: properly handle strict rendering mode switch 2020-05-18 17:46:31 +02:00
Nekotekina 72fedccaba rsx_utils.h: fix signed/unsigned comparison 2020-05-18 00:51:57 +03:00
Nekotekina ae519200ed Implement std::countl_zero and friends
Trying to fix macos build.
2020-05-18 00:51:57 +03:00
Eladash 201d54ee08 PPU interpreters: Implement AltiVec NaNs precedence and data preservation 2020-05-18 00:35:06 +03:00
JohnHolmesII 2591d99db1 Dev: Switch to dropbox for Vulkan SDK for reliability 2020-05-17 22:01:59 +01:00
JohnHolmesII a2327de3cb Dev: Switch to alternate Qt host for reliability 2020-05-17 22:01:59 +01:00
Ani 581176fb1a gl: Restrict insert_vertex_input_fetch workaround to Intel proprietary
It works fine on Mesa iris
Fixes detection of Mesa as recent Mesa does not have "x.org" on vendor string, allowing vendor_MESA to become true instead of vendor_INTEL on Mesa Intel
2020-05-17 17:49:14 +03:00
Eladash 377e2ce3e8 rsx: Write 4-byte long data to all semaphores (#8246)
* rsx: Write 4-byte long data to all semaphores
2020-05-17 17:48:35 +03:00
Eladash a2653532ef SPU reservations (TSX): Remove wait flag in PUTQLLUC 2020-05-17 14:20:21 +03:00
kd-11 37df3c6f96 rsx/fp: Fix precision clamping on MAD instruction 2020-05-17 09:11:26 +03:00
AniLeo a8bca8b2ed gl: Only log shaders if g_cfg.video.log_programs is enabled 2020-05-16 16:16:17 +01:00
AniLeo b0d3c4d75e gl: Refactor shader type usage
Use Common/GLSLTypes.h program_domain instead of duplicated own internal
type
2020-05-16 16:16:17 +01:00
AniLeo 3db2f23e02 gl: Refactor shader compilation 2020-05-16 16:16:17 +01:00
Ani 661636efef gl: Check for EXT_depth_bounds_test
Avoid glEnable/glDisable GL_DEPTH_BOUNDS_TEST_EXT flood that returns 
GL_INVALID_ENUM if the feature isn't supported
2020-05-16 14:50:05 +01:00
AniLeo 99f5145aab glsl: Avoid implicit int->uint conversions
Silences debug output regarding implicit int -> uint conversions
2020-05-16 11:45:59 +01:00
Eladash 8a0425570c rsx: Fix data written to RSX semaphores and the initial data of them (#8235) 2020-05-16 09:55:56 +01:00
AniLeo eecb22e749 gl: Remove older debug code
KHR_DEBUG path makes this obsolete, usage of this older path has been 
removed a long time ago
2020-05-16 08:29:00 +01:00
AniLeo 3ad12cf5f8 gl: Avoid issuing glDelete calls with m_id == GL_NONE
Applies GL_NONE macro usage where it makes sense
2020-05-16 08:29:00 +01:00
AniLeo d4333788e2 glext.h: update from 20180114 to 20200423
Include newly added khrplatform.h as well
2020-05-16 08:29:00 +01:00
AniLeo 308cdfac35 gl: Rewrite Debug Output
Remove Windows restriction, enable Debug Output for every supported OS
Filter our severity by Khronos severity
Handle and log source and type enums
2020-05-16 08:29:00 +01:00
illusion db4414ca87 GUI followup for https://github.com/RPCS3/rpcs3/pull/8148 2020-05-15 20:01:39 +03:00
Zion b5dbb2eb36 Bump Linux CI version (#8226)
This updates Qt to 5.14.2, Ninja to 1.10.0, SDL2 to 2.0.12
2020-05-15 04:04:24 +01:00
Nekotekina 67b002f586 Update Contributors 2020-05-15 01:46:12 +03:00
Nekotekina e186ef9490 Update Developers 2020-05-15 00:53:39 +03:00
Nekotekina cccc5bc18d Update Supporters 2020-05-15 00:50:13 +03:00
Nekotekina 7824419bbf Remove std::rotr usage for now
It seems to be missing on some std implementations.
2020-05-14 21:42:44 +03:00
Mrlinkwii c22d778143 Spelling fix in texture_cache.h (#8219)
heurestic_end -> heuristic_end
2020-05-14 21:42:21 +03:00
Eladash 61f43d78df SPU: Minor cleanup of exception in stop_and_signal 2020-05-14 16:58:50 +01:00
Eladash 54dd9f4eae sys_spu: Fix sys_spu_thread_group_terminate vs sys_spu_thread_group_exit race on values 2020-05-14 16:58:50 +01:00
Eladash 91d06a9729 SPU LLVM: fixup after #8175 (#8214)
Mask out RESULT cmd bit, do not create unbound branch blocks. (non-TSX)
2020-05-14 13:34:14 +01:00
kd-11 310f367fb1 rsx: Improve blit engine memory validation (#8215)
- In blit engine logic there is a tendancy to over-allocate so as to avoid having to sticth together textures later
- Sometimes this can lead to out of bounds access and crash applications, so memory must be validated
2020-05-14 12:57:58 +01:00
Nick Renieris b1fb5b6239 Emu/Config: Add option for accurate PPU LLVM vector NaNs
Turned off by default.
2020-05-14 11:14:28 +01:00
Nick Renieris 20d8d38e53 PPU Interpreter: Accurate vector instruction NaNs
Tested with https://github.com/RPCS3/ps3autotests/tree/master/tests/cpu/ppu_vpu.
This commit gets us from 2746 to 353 different lines compared to realhw.
2020-05-14 11:14:28 +01:00
Nick Renieris 78ac2a86bb PPU LLVM: Accurate vector instruction NaNs
Tested with https://github.com/RPCS3/ps3autotests/tree/master/tests/cpu/ppu_vpu,
results in that test improved by about half.
2020-05-14 11:14:28 +01:00
kd-11 cc723ed45c vk: Properly fix dynamic state descriptors 2020-05-13 22:20:43 +03:00
kd-11 ed82288c1b rsx/fp: Support more types of texture access
- Allows more instructions to correctly decode depth textures
2020-05-13 22:20:43 +03:00
Eladash 7680466e0d Minor EFAULT fix in sys_semaphore_get_value/sys_event_flag_get
ESRCH preceeds EFAULT in both syscalls.
2020-05-13 19:36:44 +03:00
Eladash 9266507e4c SPU: Implement spu_channel_(4_)t::try_read 2020-05-13 19:36:44 +03:00
Eladash 8cca113ef4 sys_spu: Add short sleep in sys_spu_thread_group_terminate 2020-05-13 19:36:44 +03:00
Eladash 7ff25588f4 sys_spu: Minor cleanup of group termination process 2020-05-13 19:36:44 +03:00
Eladash 93122196d9 vm: Fix vm::passive_lock regression (#8175)
possible broken signaling in rare occusions.
2020-05-13 16:53:59 +03:00
Eladash 5c4c8f4539 PPU: Use optimized reservation waiting for reservation load (non-TSX) 2020-05-13 16:53:59 +03:00
kd-11 118bfbbe98 rsx: Rewrite data texture remap expansion
- 16-bit channel formats have special 0x4|0xE encoding for only 2 channels, not 4
- float textures do not take any remapping and crash if you try it.
  Depth float textures work fine though.
2020-05-13 14:33:22 +03:00
Eladash 12f0278808 SPU LLVM: Improve MFC transfers recompilation for non-TSX 2020-05-13 11:10:13 +01:00
Eladash b38580bf32 SPU: Use optimized PPU signaling to SPU on reservation pause 2020-05-13 11:10:13 +01:00
Eladash 525453794f SPU/PPU reservations: Optimizations part 1
- Implement vm::reservation_trylock, optimized locking on reservation stores with no waiting. Always fail if reservation lock bitsa are set.
- Make SPU accurate GET transfers on non-TSX not modify reservation lock bits.
- Add some optimization regarding to unmodified data reservations writes.
2020-05-13 11:10:13 +01:00
Megamouse eb5ec211c2 Input: remember registered ldd controllers
- Don't reset ldd pads when saving a pad config
- Prevent configuration of registered ldd pads in the gui while ingame
2020-05-13 11:17:58 +02:00
JohnHolmesII 69ea573b0d vk: Remove more deprecated VK_DYNAMIC_STATE_RANGE_SIZE usage (#8206) 2020-05-13 02:52:01 +01:00
kd-11 dd9397473a vk: Remove deprecated enum VK_DYNAMIC_STATE_RANGE_SIZE (#8202) 2020-05-12 22:36:55 +01:00
sampletext32 86cf8a1717 Fix possible cur_ip nullptr usage in np_handler.cpp 2020-05-12 18:28:12 +02:00
Megamouse 6374a9f19b Qt: remove debug tab wall for Utilities menu
In order to make it easier for the user to take RSX captures.
2020-05-12 16:48:56 +02:00
Eladash f95b81574f sys_spu: Fix race in sys_spu_thread_group_destroy and other minor fixes (#8182)
* sys_spu: Fix race in sys_spu_thread_group_destroy and other minor fixes

* SPU: Wait for all threads to have error codes if exited by sys_spu_thread_exit

On last thread in group to run.

* sys_spu: Fix sys_spu_thread_group_start

* fixup ad fix sys_spu_thread_group_terminate

idk why "- !group->running" was put in the first place but its probably no longer relevant due to other changes and was causing other issues such as not always waiting for last SPU thread to set group state to INITIALIZED.
2020-05-11 21:24:04 +03:00
Maxim Kulyk d67e77899f [CI] xenial 1.2->1.3 2020-05-11 16:40:28 +03:00
RipleyTom dd5c54290c Improves skylander generation (#8177) 2020-05-11 11:57:13 +01:00
kd-11 b6e8560532 rsx/fp: Fix PK2/UP2 instruction
- These variants take unsigned scalar inputs, not signed.
- Fixes ARGB8->X16Y16 in SR: Gat out of Hell
2020-05-11 09:37:00 +01:00
Maxim Kulyk 5dc8b05275 [CI] Update VulkanSDK to 1.2.135.0 2020-05-10 21:13:04 +01:00
Maxim Kulyk 48ecc00368 [msbuild] Exctract Cmake cmd line to variable
Same change as was made for llvm_build
2020-05-10 21:13:04 +01:00
Maxim Kulyk 04ead3cba4 [msbuild] Change vulkan libs dir search priority
VulkanSDK 1.2.135.0+ comes with a lot more libs including glslang.lib and SPIRV*.lib. This allows to load all rpcs built libs first.
2020-05-10 21:13:04 +01:00
kd-11 79e2a87bc5 rsx: Fix NOP shader passing
- NOP shaders are used to stub rendering when a pass is supposed to be disabled
2020-05-10 21:54:34 +03:00
Eladash bd61347b21 sys_spu: reset group exit status in sys_spu_thread_group_start 2020-05-10 03:46:11 +01:00
Eladash 09797c3584 sys_spu: Improve sys_spu_thread_get_exit_status 2020-05-10 03:46:11 +01:00
kd-11 14969cd8d0 rsx: Disable SCA writes to output register if vec result flag is set.
- Noticed when debugging X-men origins: wolverine which has a bogus SCA op whilst writing vector to output
- It makes no sense for both SCA and VEC to both write to the same register in the same instruction as memory ordering becomes an issue
2020-05-08 14:35:07 +03:00
kd-11 79c54aeba9 rsx: Move analyser dump to its own config option 2020-05-08 14:35:07 +03:00
kd-11 a1b6415c5a rsx: Fix alpha ref
- The alpha ref register is compared directly to the ROP output register in realhw
- alpha ref content must match bit-width of ROP register, which means fp16 values are possible
2020-05-08 00:02:47 +03:00
Megamouse 8e2b2bc179 Don't load custom configs when adding games 2020-05-07 18:10:49 +02:00
Nekotekina e1042bc631 Get rid of "module" keyword
Workaround some intellisense problems.
2020-05-06 18:20:11 +03:00
Eladash a6025df7de vm: reset stack memory after deallocation 2020-05-06 18:03:37 +03:00
Megamouse 5c4b8e8dee Input: fix xinput deadzones 2020-05-06 09:33:38 +02:00
Megamouse f95bf01c78 Input: fix trigger scaling
this is not a problem at the moment, but if you increase the trigger_max then the old code reports values bigger than 255
2020-05-06 09:33:38 +02:00
Megamouse d4606cfdb9 Input: remame some functions 2020-05-06 09:33:38 +02:00
Nekotekina 907adc817e Fix some warnings (GCC) 2020-05-05 21:55:22 +03:00
Nekotekina a6f0b1b532 Fix get_thread_affinity_mask (Linux/BSD)
Uninitialized variable (facepalm).
2020-05-05 21:44:32 +03:00
Eladash 1bd6cb2105 SPU/PPU debugger: use ':' instead of '=' 2020-05-05 13:46:26 +03:00
kd-11 142a1da0e0 Fix windows build 2020-05-05 13:18:03 +03:00
kd-11 fb3d5827f0 Fix linux build 2020-05-05 13:18:03 +03:00
kd-11 a3f25bc7c7 rsx/interpreter: Fix DIVSQ instruction 2020-05-05 13:18:03 +03:00
kd-11 a0f63a31e3 vk: Enable optimization passes for generated SPIRV 2020-05-05 13:18:03 +03:00
kd-11 f72385b00c vulkan: Import spirv-tools subproject and update glslang 2020-05-05 13:18:03 +03:00
kd-11 4f7c020e63 glsl: Improve VGPR usage
- VGPR usage lowered from 159 -> 127 for texturing. Occupancy doubled from 1 to 2
- Eliminate most temporary registers
2020-05-05 13:18:03 +03:00
Pavel 9a4c26dc8c Qt: Option to disable keyboard hotkeys 2020-05-04 01:10:44 +03:00
Eladash edde748519 sys_event_queue: Fix forced event queue destruction
Add missing last existence check at sys_spu_thread_(try)receive_event and lv2_event_queue::send.
2020-05-04 01:10:19 +03:00
Eladash 37ce7056ac lv2: Minor optimization for "awake all" threads in sleep queue 2020-05-04 01:10:19 +03:00
Eladash b84b8f4db4 sys_cond_signal_all: Use SYS_SYNC_PRIORITY protocol to signal threads 2020-05-04 01:10:19 +03:00
Eladash 72bef8dd7f PPU: Clear reservation on context switch
Ensure that only 2 PPU reservations exist at maximum at a time.
2020-05-02 14:57:38 +03:00
Eladash 0e6937a359 SPU GETLLAR: Don't use loop detection for TSX 2020-05-02 14:57:38 +03:00
MSuih b18dcd7660 Add fs::error for when disk is full 2020-05-02 14:54:41 +03:00
Megamouse 2b69a68ef6 Qt: show mouse in fullscreen 2020-05-02 09:27:54 +02:00
Nekotekina fc68c508c8 LLVM DSL: fix FNeg pattern matching 2020-05-01 22:00:57 +03:00
Nekotekina cda8b3a59e RSX: fix new warnings 2020-05-01 22:00:57 +03:00
Nekotekina 31035608ee Use utils::get_cpu_brand when applicable 2020-05-01 22:00:57 +03:00
Nekotekina f6200ba635 Implement thread_ctrl::get_process_affinity_mask() 2020-05-01 22:00:56 +03:00
Malcolm Jestadt c1bd154bcd SPU: Optimize FMA ops with 0 addend 2020-05-01 17:52:10 +03:00
Megamouse a568c958af evdev: simplify evdevbutton madness a bit
I hope this doesn't regress anything
2020-05-01 12:03:06 +02:00
Megamouse 2de6a9bc44 evdev: revert facepalm change 2020-05-01 12:03:06 +02:00
AniLeo 7df8258551 rpcs3_version: Bump to 0.0.10 2020-04-30 19:40:32 +01:00
Eladash 2b75df22d9 sys_event_queue: Fix ports disconnection after queue destruction 2020-04-30 18:58:42 +03:00
Eladash 37110098c7 cellAudioOut Improvements 2020-04-30 15:45:20 +03:00
Megamouse 8f0af6a6fe rsx/interpreter: merge shader settings
- merge disable_asynchronous_shader_compiler and interpreter_mode
- removes disable_asynchronous_shader_compiler setting
- Adds the resulting settings as radio buttons to the gui tab
2020-04-30 15:02:59 +03:00
kd-11 2281c4f662 Fix build 2020-04-30 15:02:59 +03:00
kd-11 2ed50ba263 rsx/interpreter: Improve instruction accuracy
- Fix DIV instruction
- Add EXP_TEX modifier
- Implement WPOS register read
- Swap 3D and Cubemap enums to match RSX ids
- Adds two extra instruction classes: flow control and packing control
- Implement remaining FP instructions with exception of the rare projected texture lookups
- Fix typo causing output color index > 0 to not work
- Fix KIL instruction
- Implement conditional vertex program writes
2020-04-30 15:02:59 +03:00
kd-11 fc5b4026e1 vk: Implement optimized pipeline cache 2020-04-30 15:02:59 +03:00
kd-11 bc5c4c9205 rsx/gl: Implement variable path interpreter for optimal performance 2020-04-30 15:02:59 +03:00
kd-11 930bc9179d rsx/interpreter: Improve instructions support
- Must statically write the gl_ClipDistance registers else you get uninitialized trash.
  This problem is more readily apparent on NVIDIA technology but even AMD is not completely immune.
2020-04-30 15:02:59 +03:00
kd-11 b4bf48c33b vk: Integrate shader interpreter 2020-04-30 15:02:59 +03:00
kd-11 0072df7f20 rsx/gl: Add basic interpreter support to OGL
- Adds basic interpreter functionality.
- Flow control and other instructions not yet implemented.
2020-04-30 15:02:59 +03:00
kd-11 65e9e568b5 config: Register shader interpreter modes 2020-04-30 15:02:59 +03:00
Nekotekina 19acf260d8 SPU DMA: Fix PUTLLUC (TSX)
Prevent edge case of missing store.
2020-04-29 15:40:41 +03:00
Eladash f4f0fb88b1 kernel explorer: Add more information about SPU/PPU threads 2020-04-29 15:32:16 +03:00
Eladash dd6825a7bd Fix sys_ppu_thread_start error checking, fix rare bug in sys_ppu_thread_create
* Correct error code to EBUSY.
* lv2_obj::awake was called even when EBSUY should be returned.
* Fix sys_ppu_thread_create for a newly created thread with the same id as ppu_thread::id_base. (can happen if main thread exited before its creation)
2020-04-29 08:58:09 +03:00
Eladash c1dc6838fa Fix sys_ppu_thread_get_priority page faults 2020-04-29 07:57:47 +03:00
Eladash 69f82a7311 Make spu_mfc_cmd fmt properly show stalled commands 2020-04-29 07:47:49 +03:00
Eladash 0db91aa56b Fix address_range start_length() constructor
Fixes an underflow when constructing start_length(0, 0).
2020-04-29 06:47:35 +03:00
Eladash 791ec95313 sys_rwlock: Do not allow SYS_SYNC_PRIORITY_INHERIT 2020-04-29 05:56:47 +03:00
Eladash 954e3f6e6c Fixup for cpu_flag::pause state check after #8114 2020-04-29 05:56:47 +03:00
Nekotekina d66bdf1653 TSC calibration improvements
Bind main thread to a single core for calibration.
Issue RDTSC after clock probing, may improve accuracy.
2020-04-29 00:09:40 +03:00
Nekotekina 76294beae1 Implement thread_ctrl::get_thread_affinity_mask() 2020-04-29 00:09:40 +03:00
Nekotekina 689419b0ca Remove test_stopped() check from ppu_load_acquire_reservation
Fixes warning.
2020-04-29 00:09:40 +03:00
Eladash 833ace1190 rsx: Fix zcull time to not time travel to the future 2020-04-28 21:07:15 +03:00
Megamouse e095eaf16e Qt: update playtime every 10 seconds 2020-04-28 19:44:09 +02:00
Eladash a505d87565 Partial revert of 3be687cd18 2020-04-28 20:20:19 +03:00
Nekotekina 98ab5d5ba2 atomic.hpp: modernize inline assembly for lock bts/btr/btc
Use flag output (requires clang 9+).
2020-04-28 18:05:32 +03:00
Nekotekina 790fd9ce14 SPU DMA: implement cmp_rdata_avx
Use technique similar to mov_rdata_avx with inline assembly.
2020-04-28 17:58:26 +03:00
Eladash 7da8ba5c15 Wait for SPU event to be received in sys_spu_thread_group_exit
Also use atomic check for group->run_state outside the mutex,
explicitly forbid group termination while we are waiting for an event to be received.
2020-04-28 14:58:17 +03:00
Eladash a9c18964b6 Add missing cpu state check sys_spu_thread_receive_event 2020-04-28 14:58:17 +03:00
Eladash fe7933b0d2 Make ESTAT consistent in sys_spu_thread_group_terminate 2020-04-28 14:58:17 +03:00
Eladash 9506676223 SPU debugger: dump Stall Stat and SRR0 2020-04-28 14:27:40 +03:00
Eladash 7d7909149f SPU: Detect reservation spinning loop 2020-04-28 14:27:40 +03:00
Eladash 3be687cd18 PPU: Fix LWARX/LDARX on TSX path 2020-04-28 14:27:40 +03:00
Eladash e423128a32 SPU: New GETLLAR technique 2020-04-28 14:27:40 +03:00
Nekotekina 3ec73b651e SPU DMA: more tuning for mov_rdata_avx
Avoid unaligned stores.
Prefer asm path if __AVX2__ is not set.
Don't emit vzeroupper if __AVX__ is set.
2020-04-27 18:05:52 +03:00
Nekotekina 4f71c570bd SPU DMA: disable memcpy path
Due to update of the alternative path (SSE/AVX)
2020-04-26 22:36:55 +03:00
Nekotekina 8ae2554505 Implement mov_rdata_avx 2020-04-26 22:36:45 +03:00
Maxim Kulyk c5d390c979 [llvm_build, msbuild] Minor refactor 2020-04-26 18:28:19 +03:00
Megamouse 8e95c0e44d evdev: add keys used by wii controller driver
I'll probably rework the current system sometime soon so that I don't have to add keys every now and then
(or I'll just add them all XD)
2020-04-25 22:55:08 +02:00
Nekotekina 58ba6d68bb Don't use std::popcount (workaround)
It seems MSVC uses POPCNT instruction when compiling for SSE2.
2020-04-25 18:01:39 +03:00
Megamouse 3788ef3e27 evdev: fixup for relax controller criteria 2020-04-25 16:37:20 +02:00
Megamouse b923eb058a Crypto: read sfo in memory instead of tmp file 2020-04-25 15:17:17 +02:00
Megamouse 773448a8f6 Crypto/Qt: check target app version for packages 2020-04-25 15:17:17 +02:00
Megamouse af854835b2 Qt: Rename some functions in settings_dialog 2020-04-25 15:17:17 +02:00
jacob1218 72ab5f05f4 change minimum audio buffer duration 2020-04-25 15:27:18 +03:00
scribam 1791bb5059 Qt: Remove "#pragma once" in a cpp file 2020-04-25 14:56:47 +03:00
scribam 3fd3bd7ca1 spu: Add some "if constexpr" 2020-04-25 14:56:47 +03:00
Megamouse 3937733182 evdev: relax controller criteria 2020-04-25 10:50:38 +02:00
Megamouse de58f19866 input: add Rock Revolution Drum Controller product info 2020-04-25 10:17:48 +02:00
Megamouse e4cb9ef7cd cellpad: add pclass_profile flags 2020-04-25 10:17:48 +02:00
Megamouse 4e6d95c5b8 Qt/input/cellpad: enable product choice 2020-04-25 10:17:48 +02:00
Eladash 256c74def2 sys_rsx: Fix error code instead of success on invalid context 2020-04-23 14:01:04 +03:00
Eladash c48ccc6f3c sys_rsx: Fix zcull bind error checking regression 2020-04-23 14:01:04 +03:00
Megamouse 18219afbf7 Qt: move rsx capture to Utilities menu 2020-04-22 21:43:03 +02:00
Megamouse 1805cb44e6 Qt: move GetBootConfirmation to gui_settings 2020-04-22 21:43:03 +02:00
Megamouse b4b8c1e4b2 Qt: Add confirmation dialogs on drag and drop 2020-04-22 21:43:03 +02:00
Megamouse 193837298b Qt: enum class drop_type 2020-04-22 21:43:03 +02:00
Megamouse 18e0b83ac9 Qt: some cleanup 2020-04-22 16:58:20 +02:00
Megamouse 1a374126e1 Qt: move GetSettingName to cfg_adapter 2020-04-22 16:58:20 +02:00
Megamouse 2b6afb6916 Qt: Add confirmation dialogs before closing games 2020-04-22 16:58:20 +02:00
Megamouse ebd92a2f2f Qt: Add Firmware Cache options to main window menu 2020-04-22 16:58:20 +02:00
Eladash 8c747bf0a2 sys_rsx: More error checks for ZCULL area binding
And clamp zcull offset to 256MB, it's unknown if only the error check clamps or it is clamped entirely.
2020-04-21 16:18:32 +01:00
Eladash b94e4247cc rsx: More strict zcull stats enabling 2020-04-21 16:18:32 +01:00
Megamouse a203ff677b settings: remove legacy settings 2020-04-20 20:56:07 +02:00
Megamouse c3af19148f settings: fix clocks scale default 2020-04-20 20:56:07 +02:00
Eladash dbce10d0e3 PPU LLVM: Fix rounding regression of FNMADDS, FNMSUBS (#8066)
* PPU LLVM: Fix rounding regression of FNMADDS, FNMSUBS
2020-04-19 20:55:26 +01:00
rxys 5101bc189e Fix FMA copypasta (#8060) 2020-04-19 19:17:19 +01:00
Eladash 5960de2e20 PPUAnalyzer: Check if TOC from OPD is a valid address 2020-04-19 10:56:42 +01:00
Eladash 1cb3bf6dab Minor fixup for unimplemented syscall args dump 2020-04-19 10:56:42 +01:00
Eladash 0bf73ba0bc PPU debugger: report functions on registers display 2020-04-19 10:56:42 +01:00
Eladash 368bd7cf02 PPU debugger: read 32-bit pointer instead of 64-bit
PPU ABI supports only 32-bit pointers in userland, also fix it to use super ptr.
2020-04-19 10:56:42 +01:00
Eladash 83c7f6f149 debugger: Rephrase "Current function" to "In function"
Takes less space which makes actual function name display a bit nicer.
Also the meaning is clearer.
2020-04-19 10:56:42 +01:00
Megamouse 2094e52d7d Crypto: add another file type for PSVita 2020-04-18 19:11:53 +02:00
Megamouse 5657363642 Crypto: move PSVita keys to key vault 2020-04-18 19:11:53 +02:00
Megamouse d35a29bbe4 Crypto: PSVita metadata and missing entry type 2020-04-18 19:11:53 +02:00
Megamouse 22d01e4d05 Crypto: interpret metadata versions 2020-04-18 19:11:53 +02:00
Megamouse 1762324702 Crypto: fix metadata variable names
header_size was just wrong, on PS3 games it just happens to match the meta offset, which is half of data_offset
PS3: meta_offset + meta_size = data_offset
PSP: meta_offset + meta_size = metadata_header_hmac_offset
PSP: metadata_header_hmac_offset + ext_data_size = data_offset
2020-04-18 19:11:53 +02:00
Megamouse e4b6de409a Crypto: fix magical type 2020-04-18 19:11:53 +02:00
Megamouse 3a6bda4d93 Crypto: read and log PSP and PSVita headers 2020-04-18 19:11:53 +02:00
Megamouse 3b9dc29781 Crypto: add log verbosity to pkg installations
also enables installation with one more filetype
2020-04-18 19:11:53 +02:00
Eladash 6210507a37 sys_rsx: Fix tiles on MAIN memory error checking 2020-04-18 10:20:03 +03:00
Megamouse 0df6c41556 Qt: move code from emu_settings to config_adapter 2020-04-17 15:46:46 +02:00
Megamouse 7ba5f1f503 Qt: adjust max llvm thread tooltip 2020-04-17 13:30:10 +02:00
Megamouse 171367fe88 Qt: fix localization in change_microphone_type
Don't rely on localized text at all. Use the setting's index and formatted string instead
2020-04-17 13:30:10 +02:00
Megamouse ec4e8eda04 Qt: implement GetIsDynamicConfig in emu_settings
- unused at this point
2020-04-17 13:30:10 +02:00
Megamouse e361bac945 Qt: minor cleanup 2020-04-17 13:30:10 +02:00
Eladash 06d4505992 sceNp: Override k_licensee for PE game category
Co-Authored-By: AniLeo <ani-leo@outlook.com>
2020-04-17 11:41:50 +01:00
Eladash a3f2dfa232 sys_isolated_spu 2020-04-17 11:41:50 +01:00
Eladash 921b1aadfb lv2: Log all arguments of unimplemented syscalls 2020-04-17 11:41:50 +01:00
rexys 8f3b04cbd6 rsx: Fix is_fifo_idle with hle gcm 2020-04-16 12:59:19 +03:00
Nekotekina 0f6a0d2740 Expand vm::g_addr_lock to 64 bit to support ranges
Optimization.
2020-04-16 02:25:43 +03:00
Nekotekina c7fe8567b8 Experimental squashing of reservation memory area.
Enables trivial synchronization between shared mem.
Reduces memory usage, but potentially degrades performance.
Rename an overload of vm::passive_lock to vm::range_lock.
2020-04-16 02:25:43 +03:00
Eladash 8cb1f4fe26 liblv2 HLE: Fix spu_elf_info loader for SCE SPU images (#8045) 2020-04-15 21:19:46 +01:00
Megamouse cf229a8e9f some more dynamic settings 2020-04-15 18:25:25 +02:00
Nekotekina 074b9f94db Fix regression in SPU ASMJIT
Incorrect arithmetics.
2020-04-15 12:19:15 +03:00
scribam 20f53e65eb cmake: Add support for target_precompiled_headers if available 2020-04-14 23:00:51 +03:00
Nekotekina b1b67a13c6 Revert "Replace rotate utils with std::rotl" (partial)
This reverts commit 4d8bfe328b.
2020-04-14 19:45:53 +03:00
Eladash bc3b70c338 Fix ppu_rotate_mask 2020-04-14 19:10:30 +03:00
Eladash 63be05d5d3 minor ppu fixup
does not affect anything except consistency.
2020-04-14 17:09:58 +03:00
Eladash ec1e82bc9d SPU debugger: Implement blocking functions dumping 2020-04-14 17:09:58 +03:00
scribam 2e397e38a4 Typos 2020-04-14 17:06:58 +03:00
scribam 7e0bc26241 Add missing break in cheat_manager.cpp 2020-04-14 17:06:58 +03:00
scribam f37adc4188 Add fallthrough attribute 2020-04-14 17:06:58 +03:00
Nekotekina 4d8bfe328b Replace rotate utils with std::rotl
More include cleanup.
2020-04-14 16:05:58 +03:00
Nekotekina f72af2973d Replace utils::popcnt32 with std::popcount
Cleanup includes.
2020-04-14 16:05:58 +03:00
Nekotekina 032e7c0491 Replace utils::cntlz{32,64} with std::countl_zero 2020-04-14 16:05:58 +03:00
Nekotekina d0c199d455 Replace utils::cnttz{32,64} with std::countr_{zero,one}
Make #include <bit> mandatory.
2020-04-14 16:05:58 +03:00
JohnHolmesII adfc9d93c3 CI: Auto update LLVM and GLSLANG when those releases change (#8021) 2020-04-14 08:15:05 +01:00
Eladash 2dcc3255b2 Fix sys_net_bnet_sendto (#8026) 2020-04-13 18:49:12 +01:00
JohnHolmesII 167159698d Fix overloaded virtual warning 2020-04-13 14:37:11 +03:00
JohnHolmesII 4838f72e50 Prevent unecessary copy in loop 2020-04-13 14:37:11 +03:00
JohnHolmesII a8a83c9724 cellRtc: Extend before shift, per decompiled output 2020-04-13 14:37:11 +03:00
JohnHolmesII f0b1c8302a Fix order of operations warning 2020-04-13 14:37:11 +03:00
Eladash c8b8cafeec PPU: Merge reservations store functions into one 2020-04-13 14:34:37 +03:00
RipleyTom 791c0da236 Add Disney Portal to passthroughs (#8022) 2020-04-13 11:49:42 +01:00
Eladash b45d836b89 sys_net: Fix sys_net_bnet_bind page faults
+ EINVAL checks
2020-04-13 04:34:10 +01:00
Eladash 492a80f6c5 CPUThread.cpp: Minor indetation fixup 2020-04-13 04:34:10 +01:00
Eladash 8f32d44635 sys_net: Fix sys_net_bnet_sendto 2020-04-13 04:34:10 +01:00
Eladash 9fb30f130a sys_net: Fix sys_net_bnet_getsockopt
+ EINVAL checks
2020-04-13 04:34:10 +01:00
Eladash d91d420981 sys_net: EINVAL check in sys_net_bnet_listen 2020-04-13 04:34:10 +01:00
Eladash 442035c251 sys_net: EINVAL checks in sys_net_bnet_accept 2020-04-13 04:34:10 +01:00
Eladash 063902728b sys_net: EINVAL checks in sys_net_bnet_recvfrom 2020-04-13 04:34:10 +01:00
Eladash 60a63fa4b6 sys_net: Fix sys_net_bnet_getsockname page faults
+ EINVAL checks
2020-04-13 04:34:10 +01:00
Eladash 7399a3f1e9 sys_net: Fix sys_net_bnet_getpeername page faults
+ EINVAL checks
2020-04-13 04:34:10 +01:00
Eladash c4f6968aae sys_net: Fix sys_net_bnet_connect page faults
+ EINVAL checks
2020-04-13 04:34:10 +01:00
Eladash 00957ca4bf sys_net: Fix sys_net_bnet_select page faults 2020-04-13 04:34:10 +01:00
Eladash 179a9b3bf0 sys_net: Fix sys_net_bnet_poll page faults 2020-04-13 04:34:10 +01:00
Eladash 926e0467cf Another ::as_rvalue fixup 2020-04-13 04:34:10 +01:00
sampletext32 c69691f19b Fix various explicitness, laziness, hard codes 2020-04-12 17:29:42 +03:00
Nekotekina 5524cd1e75 Improve TAR loader
Don't overwrite unchanged files.
Print error if failed to overwrite.
This commit affects PS3 firmware installation.
Trying to workaround a bug where some files cannot be overwritten.
2020-04-12 16:56:21 +03:00
Nekotekina 17f3a114be Fat atomics: implement exchange() and compare_exchange()
Also includes compare_and_swap() and compare_and_swap_test().
Also includes fixes for load(), store(), and atomic_op().
2020-04-12 16:56:21 +03:00
Eladash cb14805d78 rsx fp/vp analyzers: Fix strict type aliasing and improve codegen 2020-04-12 16:48:43 +03:00
Eladash ae1ff1e96d ppu exec loader: Log TLS image information 2020-04-12 10:30:38 +01:00
Eladash c3a4e57efe Reduce log level of page fault notifications
Log current hle function.
2020-04-12 10:30:38 +01:00
Eladash bb950cbb3b vm: Fix possible IDM deadlock with Page Fault Notifications (partial) 2020-04-12 10:30:38 +01:00
Whatcookie 6b0f7a8f55 PPU LLVM: Optimize altivec FMA with 0 addend (#8013)
- When VMADDFP and VNMSUBFP are used with a constant addend of 0, they can be simplified into a single floating multiply
2020-04-12 09:52:21 +01:00
Eladash 8e61c65c0d Fixup ::as_rvalue 2020-04-11 22:55:55 +03:00
Eladash 141d62fbf9 Implement ::as_rvalue 2020-04-11 21:58:36 +03:00
Eladash e407018bb5 rsx: Write ref+get atomically
May contribute to better FIFO synchronization in some cases.
2020-04-11 21:21:15 +03:00
Eladash ff74c241c7 rsx: Fix get_optimal_blit_target_properties for local memory 2020-04-11 21:21:15 +03:00
Eladash d69bec8f59 rsx: Fix vblank thread stop regression 2020-04-11 21:21:15 +03:00
Eladash 504ba8d824 rsx: Fix grammer issue (binded -> bound) 2020-04-11 21:21:15 +03:00
Eladash 8228fa1ece sys_rsx: Warn if RSX is not idle during crucial points 2020-04-11 21:21:15 +03:00
Eladash 1f9f455801 sys_rsx: Implement error checks for Zcull/Tiles binding
* Check zcull/tiles offset if bigger than max MAIN/LOCAL size.
* Check memory mapping of offset if location is MAIN.
* Check pitch/size for 0 as coming from hw tests.
* In addition: fix 'bound' check of tiles, seem to rely on the bits location is in.
* Add locks for zcull/tiles/displaybuffer binding.
2020-04-11 21:21:15 +03:00
Eladash 5ba26e247b sys_rsx: Implement LLE cellGcmSysGetLastVBlankTime 2020-04-11 21:21:15 +03:00
Eladash 93b8f3b5db idm: Minor update to use std::static_pointer_cast 2020-04-11 10:58:24 +03:00
RainbowCookie32 11b980c9ac Show state of Accurate LLVM DFMA option in GUI for CPUs that support FMA 2020-04-11 10:48:51 +03:00
illusion df20410cf1 gui: don't allow cpu with fma support disable accurate path 2020-04-09 19:22:04 +03:00
Eladash d451a0b7b7 SPU LLVM: Improve FNMS
Should be more accurate with postive/negative zero inputs according to docs while being more optimized.
TODO: Check SPU precise interptreter.
2020-04-09 17:27:14 +03:00
Eladash 158b24ec25 SPU LLVM: Add accurate double-precision FMA support 2020-04-09 17:27:14 +03:00
Nekotekina 1b68f90e42 Tweak TSC calibration
Round to 3 digits after dot (count in MHz).
2020-04-09 16:23:33 +03:00
clienthax 765b14a8ba Implement cellRtc HLE (#7933) 2020-04-09 15:54:41 +03:00
Eladash 36fd1d0f0d rsx: Optimize transform constants load methods (#7992) 2020-04-09 15:53:43 +03:00
JohnHolmesII e8f9fd5430 CI: Unify spacing for build scripts 2020-04-09 13:02:07 +03:00
JohnHolmesII c4a21438ad CI: Maintenance
- Rename .travis dir to .ci, since it isn't just for Travis
- Convert Linux build scripts to posix sh
- Clean up some scripts per shellcheck
2020-04-09 13:02:07 +03:00
JohnHolmesII c2ae8be3eb CI: Fix facepalm bug in Azure build 2020-04-09 13:02:07 +03:00
JohnHolmesII 6fe671a5e8 CI: Prevent Azure from publishing empty files 2020-04-09 13:02:07 +03:00
Eladash cce946f10e spu: typo fix 2020-04-08 19:23:13 +03:00
Eladash c948c9305c sys_ppu_thread_create: read function descriptor immediately and save it 2020-04-08 19:23:13 +03:00
Megamouse 8c838698af Qt: fix time played 2020-04-08 19:20:41 +03:00
Eladash c0f4fb6e35 SPU debugger: dump reservation address 2020-04-08 14:35:44 +03:00
Eladash cc8f024c6c Fixup ppu/spu_thread::dump_all() 2020-04-08 14:35:44 +03:00
Megamouse 2e18df7223 Qt: fix renderer translation
move render creator to own class
2020-04-08 11:43:48 +02:00
Eladash 995fa63f4c sys_rsx: Fixup after #7978 2020-04-08 11:33:26 +03:00
RipleyTom dce81d4a66 fix AddLddPad when more than one ldd pad 2020-04-08 07:39:54 +03:00
Eladash f7536bbce0 sys_rsx: Fix gcm events spam
In realhw the events are only sent if they are masked in driver_info->handlers as well.
2020-04-07 20:43:28 +03:00
Eladash 3f48450408 sys_rsx: Minor atomicity fixes 2020-04-07 20:43:28 +03:00
Víctor "IlDucci a38d2461c9 Linguistic changes (#7917) 2020-04-07 17:10:04 +02:00
Nekotekina 6c8d844ec5 PPU LLVM: fix crash on damaged cache files 2020-04-07 16:51:35 +03:00
Nekotekina 91d80aa7b9 Implement jit_compiler::check
Instead of checking file existence (because file may be damaged).
2020-04-07 16:09:47 +03:00
Nekotekina 7939160178 Shorten SPU LLVM Worker name to SPUW.#
For debugging.
2020-04-07 15:55:30 +03:00
Nekotekina 3eabec0030 SPU: Fix SPU Precise interpreter 2020-04-07 15:42:27 +03:00
Eladash 8f3ad8b81a Fix cellGameDataCheckCreate2 error broken check (#7976) 2020-04-07 14:03:03 +03:00
Eladash 5834a466cd Fix utils::get_tsc_freq() (#7974)
Use magic static for once-initialization
2020-04-07 11:02:12 +03:00
Megamouse 4ff69dc0cd Qt: fix mic_none and move microphone creator code 2020-04-07 08:10:56 +02:00
Megamouse 4aae9a17c1 Qt: make trophy type translateable 2020-04-07 00:26:30 +02:00
Megamouse 5e6928a182 Qt: add disambiguations for settings translations
This prevents that the Qt linguist omits duplicate strings, which are actually supposed to be individually translateable.
2020-04-07 00:26:30 +02:00
Megamouse cc6a03cbd7 Qt: mic_none and enter_button_assign translations 2020-04-07 00:26:30 +02:00
Nekotekina 3c3ccdbf1e Round TSC calibration result towards speculated CPU base frequency 2020-04-07 00:10:08 +03:00
Nekotekina 15f01a1bf6 Implement TSC calibration
Try to get rough TSC frequency by sampling it.
2020-04-07 00:10:08 +03:00
Dzmitry Malyshau b6e52ad975 Fix CMake path to IOKit 2020-04-06 23:23:11 +03:00
Megamouse 2bd4485082 Qt: make cheat_type combobox translateable 2020-04-06 20:59:58 +02:00
Megamouse 96086d57fa Qt: implement EnhanceRadioButton 2020-04-06 20:59:58 +02:00
Megamouse 078c31c1da Qt: fix lupdate warnings (used for translation) 2020-04-06 20:59:58 +02:00
Megamouse 7a409af0b0 Qt: pad handlers translateable 2020-04-06 20:59:58 +02:00
Megamouse e6a6d7e9bc Qt: fix some translation nitpicks 2020-04-06 20:59:58 +02:00
Megamouse 133e897c8b Qt: make comboboxes in settings dialog translateable 2020-04-06 20:59:58 +02:00
Megamouse b1fdbc7fcc Move some format functions 2020-04-06 20:59:58 +02:00
Megamouse 89f16548f3 Qt: const, const everywhere 2020-04-06 20:59:58 +02:00
Eladash e7d5d17fd8 rsx: Adjust FIFO recovery to be a bit more merciful 2020-04-05 17:40:23 +03:00
Eladash bbbd06dcee Make vm::_test_map aware of overflow
+ remove vm::find_map 1024mb limit.
2020-04-05 17:40:23 +03:00
Silent fd09dde911 cellSearch: Change search state before invoking callbacks 2020-04-05 16:35:56 +03:00
kd-11 0b6e2b26fa rsx: Fix DST instruction
- It's the old-school distance vector, not the more modern distance() function
- There is seemingly no glsl function that maps to it directly.
2020-04-05 16:35:20 +03:00
kd-11 b301fecfd8 gl: Fix async shader compiler
- Removes glFinish hack.
- Adds proper server-side synchronization.
- Adds primary context detection to allow worker threads to be identified.
2020-04-05 16:35:20 +03:00
Eladash dc5cdb3bb4 sys_ppu_thread: reduce global memory stats after thread creation 2020-04-05 15:23:09 +03:00
Eladash 72d1efa383 rsx: Batch transform contants load methods 2020-04-05 15:21:56 +03:00
RipleyTom f36686b1a7 Always launch rpcs3.exe on restart 2020-04-05 14:27:13 +03:00
RipleyTom f33373ca1b Add Lego Dimensions Portal to usb passthroughs 2020-04-05 14:23:54 +03:00
Nekotekina ae140a1ac9 SPU LLVM: improve stack mirror format in Mega mode
Store first instruction for additional validation.
Should fix some problems.
I didn't touch ASMJIT.
2020-04-04 21:40:42 +03:00
Nekotekina 8053d2602a SPU LLVM: implement bisect helper (debugging tool)
Added two new settings: SPU LLVM Lower/Upper Bound
By manipulating values, conditionally avoid compiling programs.
It uses hash of the programs (64-bit start hash of SHA-1).
Programs which aren't compiled run with interpreter.
2020-04-04 21:38:40 +03:00
Nekotekina 18dbd788e6 SPU DisAsm: fix disasm for BINZ and similar instruction 2020-04-04 21:38:40 +03:00
Nekotekina a53d0d50b3 SPU LLVM: add alternative ROTQBY implementation
Used if SSSE3 is not available (exec_rotqby).
2020-04-04 21:38:40 +03:00
Nekotekina 7f9d41ac47 Implement cfg::uint for unsigned integers 2020-04-04 21:38:40 +03:00
Nekotekina f05e24e8e8 SPU LLVM: make LS loads/stores volatile
Fixes PS1 classics and possibly something else.
2020-04-04 21:38:40 +03:00
Megamouse cd64990558 Qt: fix nullptr 2020-04-04 21:38:26 +03:00
Eladash 0b24b09a06 sys_fs: Lock dev_hdd1 mount point at cellSysCacheClear 2020-04-04 19:36:16 +01:00
Eladash a178374052 sys_fs: Limit NPDRM FDs to 16
Co-Authored-By: Silent <cookieplmonster@users.noreply.github.com>
2020-04-04 19:36:16 +01:00
Whatcookie dd8a3eaac5 Util: Add FMA and INVARIANT_TSC detection (#7937) 2020-04-04 19:12:06 +01:00
Eladash 63080c22a3 Fix ppu_thread::dump_callstack() 2020-04-04 00:06:51 +03:00
Eladash 55baaea8e7 liblv2 HLE: Fix sys_lwcond_signal mode 3 2020-04-03 19:42:25 +03:00
Eladash 13820d6802 SPU debugger: Show channels data 2020-04-03 18:37:21 +03:00
Eladash 0beea91d5e Minor debugger fixups 2020-04-03 18:37:21 +03:00
Eladash 3f559cd86e Fix sys_cond_destroy (#7931)
Dereference cond count in sys_cond_destroy
2020-04-03 12:45:59 +03:00
Nekotekina 39796141fc Allow AppImage to spawn its own rpcs3 process for fatal error dialog (Linux) 2020-04-03 12:32:05 +03:00
illusion 7c972c8860 Add accurate PPU FMA to advanced tab (#7915) 2020-04-03 03:20:33 +01:00
Nick Renieris 2fb600e458 Qt/Debugger: Don't move entire list if it's not needed
With 4 buffer spaces at the bottom.
2020-04-03 01:36:35 +01:00
Nick Renieris 6cbb12e5cd PPUThread: String & hex previews for register pointers in register dump 2020-04-03 01:36:35 +01:00
Nick Renieris 2eea18469d Qt/Debugger: Call Stack panel 2020-04-03 01:36:35 +01:00
Nick Renieris 1113221340 Qt/MemoryViewer: Make it vertically resizable 2020-04-03 01:36:35 +01:00
Nick Renieris 9024ba69b4 Qt/Debugger: Split register misc state info to separate panels 2020-04-03 01:36:35 +01:00
Nick Renieris 1231274e0f CPUThread: Split dump() info to separate methods 2020-04-03 01:36:35 +01:00
Eladash 72c0aed4c1 rsx: Reset vertex program/constants at each boot 2020-04-02 20:42:12 +03:00
Eladash c2c5005278 rsx: Fix and improve fp program data invalidation 2020-04-02 20:42:12 +03:00
Eladash 2ed370093e rsx: Get rid of invalid_command_interrupt_raised 2020-04-02 20:42:12 +03:00
Eladash d97e9f7b4a rsx: Batch vertex program load methods 2020-04-02 20:42:12 +03:00
EmulationChannel 85c4321c24 Update FW 4.86 Latest Version
Updates the latest FW version according to: https://www.playstation.com/en-us/support/system-updates/ps3/

    What's New in Version 4.86
* This system software update improves system performance.
2020-03-31 22:37:30 +03:00
Nekotekina ba7f4af02b CFG: minor cleanup 2020-03-31 21:50:23 +03:00
kd-11 69d90f6fec vk: Remove NVIDIA workaround for broken partial occlusion queries
- This bug has been fixed in the latest drivers.
2020-03-31 20:53:12 +03:00
kd-11 8c847d3a4b vk: Remove RADV workaround regarding renderpass barriers
- The situation was clarified in the official vulkan spec to allow this
  behavior.
  Barriers are now only inserted by the driver when layout
transitions are requested.
2020-03-31 20:53:12 +03:00
kd-11 b327e329d6 vk: Avoid query log spam if no program is loaded 2020-03-31 20:53:12 +03:00
Eladash 92f821aeb1 PPU LLVM: Add FMA accuracy setting (#7874)
* PPU LLVM : Match PS3 for the instructions fmadd, fmadds, fmsub, fmsubs, fnmadd, fnmadds, fnmsub, fnmsubs

Co-authored-by: doesthisusername <yfirestorm@gmail.com>
2020-03-31 20:01:10 +03:00
Megamouse fc3a134e7d Emu: make "Silence All Logs" dynamic 2020-03-31 18:06:37 +02:00
Megamouse d6b8213c9f set key_vault log spam to trace 2020-03-31 18:06:37 +02:00
Megamouse f079eb4026 add cacert.pem to gitignore 2020-03-31 18:06:37 +02:00
Megamouse 28bea14d72 add missing files to visual studio project 2020-03-31 18:06:37 +02:00
Megamouse a76a4d8136 change sig_log to SIG 2020-03-31 18:06:37 +02:00
Eladash fdd7f0645d Some typos (#7908)
* sys_lwcond: replace writer lock with reader lock

* sys_rsx: Typo fix

* sys_net: Fixup for buffer reading
2020-03-31 16:44:50 +03:00
Eladash 29be815302 rsx: Implement DECR memory layout (#7906) 2020-03-31 05:12:30 +01:00
Eladash 1510505b30 Fix sys_rwlock_wlock timeout event 2020-03-30 14:22:15 +03:00
Jan Beich afce3ee2ed Qt: add more headers for non-Vulkan
rpcs3/rpcs3qt/emu_settings.cpp:111:44: error: use of undeclared identifier 'g_cfg'
        for (const auto& v : cfg_adapter::get_cfg(g_cfg, begin, end).to_list())
                                                  ^
rpcs3/rpcs3qt/emu_settings.cpp:262:60: error: use of undeclared identifier 'Emulator'
        fs::create_path(title_id.empty() ? fs::get_config_dir() : Emulator::GetCustomConfigDir());
                                                                  ^
rpcs3/rpcs3qt/emu_settings.cpp:276:39: error: use of undeclared identifier 'Emulator'
                const std::string config_path_new = Emulator::GetCustomConfigPath(m_title_id);
                                                    ^
rpcs3/rpcs3qt/emu_settings.cpp:277:39: error: use of undeclared identifier 'Emulator'
                const std::string config_path_old = Emulator::GetCustomConfigPath(m_title_id, true);
                                                    ^
rpcs3/rpcs3qt/emu_settings.cpp:308:17: error: use of undeclared identifier 'Emulator'
                config_name = Emulator::GetCustomConfigPath(m_title_id);
                              ^
rpcs3/rpcs3qt/emu_settings.cpp:319:21: error: use of undeclared identifier 'g_cfg'
        if (config_name == g_cfg.name || m_title_id == Emu.GetTitleID())
                           ^
rpcs3/rpcs3qt/emu_settings.cpp:319:49: error: use of undeclared identifier 'Emu'
        if (config_name == g_cfg.name || m_title_id == Emu.GetTitleID())
                                                       ^
rpcs3/rpcs3qt/emu_settings.cpp:322:3: error: use of undeclared identifier 'g_cfg'
                g_cfg.from_string(config.to_string(), true);
                ^
rpcs3/rpcs3qt/emu_settings.cpp:324:8: error: use of undeclared identifier 'Emu'
                if (!Emu.IsStopped()) // Don't spam the log while emulation is stopped. The config will be logged on boot anyway.
                     ^
rpcs3/rpcs3qt/emu_settings.cpp:326:51: error: use of undeclared identifier 'g_cfg'
                        cfg_log.notice("Updated configuration:\n%s\n", g_cfg.to_string());
                                                                       ^
2020-03-30 10:52:46 +02:00
Eladash 019aae8bec sys_net: Fix access violation handling (#7901)
Should fix page faults notifications on unmapped menory on Gran Turismo 5.
2020-03-30 05:53:17 +01:00
JohnHolmesII 6d32ebecca CI: Update Azure cache task to newer version 2020-03-29 14:10:07 +03:00
JohnHolmesII ad13075b36 Build: Fix potential issue with Windows builds not receiving correct
branch info
2020-03-29 14:10:07 +03:00
JohnHolmesII 8581a2775a CI: Add workaround for exporting variables in Azure
Using '-x' to echo commands in the shell causes
the Azure process commands to be processed twice
2020-03-29 14:10:07 +03:00
Whatcookie cc100f4008 Fix alignment on embedded spu elf searching (#7894)
- They are actually 128 byte (1024 bit) aligned.
2020-03-29 03:54:45 +01:00
Nekotekina cba9ed3527 CMake: add /MT for MSVC 2020-03-28 17:21:03 +03:00
Nekotekina dcc269128f SPU LLVM: runtime multithreaded compilation
Active for CPU with 12 or more threads.
2020-03-28 17:17:51 +03:00
Nekotekina aae338a91c named_thread_group: add a default constructor 2020-03-28 17:17:51 +03:00
Nekotekina 9db088e17b SPU LLVM: log hash in some places 2020-03-28 17:17:51 +03:00
illusion c2a24fd047 readme.md: Fix Azure Badge URL (#7888)
previously leads to RPCS3.glslang instead of RPCS3.RPCS3
2020-03-28 10:38:38 +00:00
Eladash 4215499b7f rsx: Fix typo in NV4097_SET_TRANSFORM_PROGRAM range 2020-03-28 11:07:34 +03:00
unknown 049825812e RSX: Restrict analyser loop error 2020-03-28 09:42:13 +03:00
Eladash 66bd8308d9 lv2: Wait for rescheduling before confirming timeouts (#7875) 2020-03-28 03:16:59 +00:00
xddxd d96dabcd60 rsx: Rename current_instrution to current_instruction (#7883) 2020-03-28 02:46:48 +00:00
Jan Beich 777f0a7c82 Implement IsDebuggerPresent on BSDs (#7880) 2020-03-28 01:57:41 +00:00
Jan Beich 58492ef92d build/cmake: add option to use system-wide libcurl package (#7882) 2020-03-28 00:49:31 +00:00
JohnHolmesII f5a51599d9 CD: Fix experimental build warning for Travis 2020-03-27 23:00:22 +03:00
JohnHolmesII 6712ac0a72 Build: Do not warn for local builds 2020-03-27 23:00:22 +03:00
Zion d6258fce54 Change target to the correct commit SHA on RPCS3/RPCS3-binaries-win side 2020-03-27 19:21:41 +03:00
AniLeo 4e28aa4681 azure: Fix win releases repository 2020-03-27 18:47:35 +03:00
JohnHolmesII 70d6a12894 CI: Port Windows build to Azure Pipelines (#7757)
* CI: Port Windows build to Azure Pipelines from Appveyor

* CI: Split Windows build into scripts

* CI: Remove Appveyor

* CI: Add GitHub Release deployment to Azure Windows Build

* VCS: Add full branch name function to rpcs3_version

The STRINGIZE macro was a little awkward, and difficult to control
at configure time. Since other version information is already
included, the full branch name is now added as a function. It's
runtime instead of compile-time checking, but it seems worth it.

* CI: Overhaul Windows setup script

Previously, there was no way of forcing a re-download
of cached dependencies when they were replaced by new ones. In
addition, there was really no verification of downloads or cache.
Now, changing a few lines at the top of the file will automagically
force a cache update.
2020-03-27 16:37:27 +03:00
AniLeo 96185af64f .gitignore: Ignore cmake autogen libusb files
Co-Authored-By: Eladash <elad3356p@gmail.com>
2020-03-27 15:26:28 +03:00
AniLeo c00ee7ed5b hle: cellSysutilNpEula
Add missing function names and stub all functions

Co-Authored-By: Eladash <elad3356p@gmail.com>

Co-Authored-By: Eladash <elad3356p@gmail.com>
2020-03-27 15:26:28 +03:00
RipleyTom cd4eed0704 Gives ANSI path to curl CURLOPT_CAINFO 2020-03-27 14:23:20 +03:00
dio-gh 2aac46efcc Update building instructions (#7872)
* Update building instructions

Makes the link for the prebuilt LLVM point to the `_mt` version now, since the previous one will fail to compile on latest.

* Update glslang link

Replaces the outdated not-shady-at-all link with the new, shiny and correct one.

* Fixing a 'the'

Fixes a 'the'.

Co-authored-by: Ani <ani-leo@outlook.com>
2020-03-27 10:34:13 +03:00
scribam a2bf0719ea cmake: Fix windeployqt command line for release builds (#7871) 2020-03-27 00:33:07 +00:00
Ani e8177906e7 System/Load: Handle PSP Remaster (#7857)
This just makes RPCS3 execute PSP Remaster games through 
psp_emulator.self
pspemu does not work yet, so the boot will fail, but at the least it 
starts loading
2020-03-26 20:03:00 +03:00
Nekotekina 17a9ce6fb9 Fix PS1 game_path
Don't assume local path has '/dev_hdd0' in it.
2020-03-26 18:32:42 +03:00
Eladash 36d8553f9c liblv2 HLE: Fix entryx of start/stop prx functions 2020-03-26 17:52:45 +03:00
Eladash 9d971e3b07 rsx: More strict infinite desync detection
6 desyncs per second for 1.5 seconds is pretty bad already.
2020-03-26 17:52:45 +03:00
Eladash 7ed570dc4a PPU LLVM: Add relocation 5 for ADDIS
+ Add some more for u16 relocations (4, 5, 6), simplify logic.
2020-03-26 17:52:45 +03:00
Nekotekina a5ba4a18df Fix windeployqt command line for release builds 2020-03-26 16:53:21 +03:00
Nekotekina 214a3ba21b Return Appveyor to VS 16.5 2020-03-26 16:48:44 +03:00
Maxim Kulyk 30a8cadf60 [MSVC] Remove unnecessary configurations and properly fix curl 2020-03-26 15:56:40 +03:00
Nekotekina 15a36bb844 Adjust llvm hash (affects nothing) 2020-03-26 15:29:15 +03:00
Nekotekina fa29c5aa94 ppu_iname: refactor to use actual strings 2020-03-26 15:28:41 +03:00
Nekotekina 8d1a9dce91 spu_iname: refactor to use actual strings 2020-03-26 15:26:55 +03:00
Eladash 453478c98b PPU LLVM: Log unsupported relocation opcode 2020-03-26 15:22:45 +03:00
Eladash ccc7cb7994 Log IDs of loaded prx modules 2020-03-26 15:22:45 +03:00
Eladash 38c8dd98b4 rsx: Implement basic infinite FIFO desync detection 2020-03-26 15:22:45 +03:00
Maxim Kulyk 433a21286a [appveyor] Update glslang and LLVM links 2020-03-26 15:21:53 +03:00
Maxim Kulyk ec4287cbd3 static RT 2020-03-26 15:21:53 +03:00
Maxim Kulyk e58fa7d51f Fix curl 2020-03-26 15:21:53 +03:00
Maxim Kulyk 70f1302fa7 [MSVC] Disable exceptions and spectre mitigation in common_default.props
Disabling exceptions in common_default.props ensures that all projects do not use them since not all projects import rpcs3_default.props.

Spectre mitigation is disabled by default unless WDK is installed so this is more of a just in case measure since rpcs3 does not need it.
2020-03-26 15:21:53 +03:00
Maxim Kulyk 3b9f419859 [MSVC] Added common props to llvm and glslang
common_default.props are now imported when building LLVM and glslang via MSVC.
2020-03-26 15:21:53 +03:00
Maxim Kulyk d26c465911 [MSVC] Move libcurl and wolfssl project files
libcurl and wolfssl were moved to rpcs3 source control to make buildsystem changes easier.

common_default.props and common_default_macros.props included to project files.
Int and Out Dirs changed to default:
<OutDir>$(SolutionDir)lib\$(Configuration)-$(Platform)\</OutDir>   <IntDir>$(SolutionDir)tmp\$(ProjectName)-$(Configuration)-$(Platform)\</IntDir>
2020-03-26 15:21:53 +03:00
Eladash 158e34faca rsx: Reset all method registers at rsx_state::init() 2020-03-25 17:51:59 +03:00
Eladash 768b4f8c65 rsx: Improve NV308A_COLOR
* Fix NV308A_COLOR methods range.
* Batch NV308A_COLOR methods execution together.
* Fix termination of bind_range<> in rsx methods binding.
2020-03-25 17:51:59 +03:00
Eladash 150d1bcdd5 sys_prx_unload_module: Implement CELL_PRX_ERROR_NOT_REMOVABLE 2020-03-25 16:22:47 +03:00
Eladash e1f2f3f081 sys_prx: Improve sys_prx_start/stop_module
* Add missing error codes, "internal" errors are ones which are not reachable from liblv2.sprx functions

* Implement SYS_PRX_NO_RESIDENT (unloading module) for _sys_prx_start_module.
2020-03-25 16:22:47 +03:00
Eladash 717dd1625c sys_prx: Implement sys_prx_get_module_list 2020-03-25 16:22:47 +03:00
Megamouse a11c77c009 Qt: fix mem leaks in screenshot and save managers 2020-03-25 11:50:06 +01:00
Megamouse 844f9683ec Qt: add naive lazy loading to screenshot manager 2020-03-25 11:50:06 +01:00
Megamouse f27de28ee9 Qt: add open file location to screenshot preview
Remove duplicate slash from screenshot path
2020-03-25 11:50:06 +01:00
Megamouse bd49ad358c Qt: move open_dir to qt_utils 2020-03-25 11:50:06 +01:00
Nekotekina 89514c043a Fix "Unknown option: updating" 2020-03-25 11:23:38 +03:00
Nekotekina b33648fd14 Implement SAFE_BUFFERS as __attribute__((no_stack_protector))
It was doing nothing outside of MSVC. Still seems doing nothing.
2020-03-25 11:18:48 +03:00
Nekotekina 471db3219d Finalize constexpr ppu_decoder<> thing
Move SSSE3 checks to runtime in PPUInterpreter.cpp
2020-03-25 11:18:48 +03:00
Megamouse fd3522436a overlays/osk: add more panels 2020-03-25 03:54:49 +01:00
Nekotekina 1ceb779a38 Make ppu_decoder<> objects constexpr (partial) 2020-03-24 13:46:46 +03:00
Nekotekina ecb6d38451 Roll back to VS 16.4 on Appveyor
Workaround VCRUNTIME140_1.dll dependency.
2020-03-24 12:28:20 +03:00
Nekotekina a936533eb1 Make spu_decoder<> objects constexpr 2020-03-24 12:18:37 +03:00
Eladash eb1de04ca8 _sys_lwmutex_lock: log new case of ESRCH 2020-03-23 23:18:21 +03:00
Eladash 2aff36647a Make sceNpDrmProcessExitSpawn(2) execute sys_game calls correctly 2020-03-23 23:18:21 +03:00
Nekotekina 19e20d9c19 Auto-Updater: increase lock file waiting timeout in the case of updating
Normal case: timeout reduced from 3s to 2s.
Updating case: increased timeout to 10s.
2020-03-23 22:52:05 +03:00
Nekotekina 3d78694590 Debug: measure initialization time (before main() function) 2020-03-23 22:18:45 +03:00
Eladash 52360b3f98 liblv2 HLE: Fix sys_lwmutex_lock assertation 2020-03-23 21:37:37 +03:00
Eladash 08e66ab14c Minor warning fixes 2020-03-23 21:37:37 +03:00
Eladash 3de41bfea7 _sys_lwcond_signal: Make mode 3 respect ordering of the sleep queue 2020-03-23 21:37:37 +03:00
Megamouse 1537f505a5 cellGem: fix move_handler::mouse left click 2020-03-23 15:10:01 +03:00
Nekotekina 5ebc538d7e Workaround for VS 16.5
Strange codegen bug didn't promote s32 to u64.
2020-03-23 14:48:49 +03:00
kd-11 4965bf7d7a gl/vk: Refactor draw call handling and stub shader interpreter
- Refactors backend draw call management to make it easier to extend
  functionality.
- Stubs shader interpreter functionality.
2020-03-23 14:47:28 +03:00
illusion a0509328d4 [README.md] Update to Visual C++ Redistributable 2019 2020-03-23 12:23:18 +03:00
Eladash 537f175f52 Another fixup after #7826 2020-03-23 11:54:19 +03:00
Eladash 017ef5a94e Minor fixup after #7826 2020-03-23 10:59:51 +03:00
Eladash cccc32fa9d sys_lwmutex/lwcond: track lwcond waiters (#7826)
In lwmutex destroy syscall, wait for pending waiters.
2020-03-23 10:30:17 +03:00
sL1pKn07 9de9ec1f01 Fix build with Qt 5.15+ 2020-03-23 07:23:56 +03:00
Megamouse ef10ed4499 Qt: Add basic screenshot manager 2020-03-22 23:40:55 +01:00
Megamouse b447e6f55d Qt: use simple curl wrapper to avoid some pitfalls 2020-03-22 19:16:25 +01:00
Megamouse 3c63db93ed Qt: fix double slash in updater tmp_folder 2020-03-22 19:16:25 +01:00
Megamouse da09badd8d Qt: simplify current_build in update manager 2020-03-22 19:16:25 +01:00
Megamouse 7f8d802bd5 Qt: fix log message in update manager 2020-03-22 19:16:25 +01:00
Megamouse 532215fb81 Qt: show welcome dialog before showing the app
Fixes interference with update manager
2020-03-22 19:16:25 +01:00
Megamouse 13e166084d Qt: use Localized::GetVerboseTimeByMs 2020-03-22 19:16:25 +01:00
Emmanuel Gil Peyrot 425e032a62 SPU: Copy with memcpy() instead of hand-rolled SSE2
In some very unscientific benchmark:
spu_thread::do_dma_transfer() was taking 2.27% of my CPU before, now
0.07%, while __memmove_avx_unaligned_erms() was taking 1.47% and now
2.88%, which added makes about 0.8% saved.
2020-03-22 15:51:03 +03:00
Nekotekina 5261886449 CURL_STATICLIB macro cleanup
Also move includes from headers. CURL is just void.
2020-03-22 14:13:52 +03:00
Nekotekina e606130262 Memoize and print r3-r6 under Current function in the ppu_thread::dump() 2020-03-22 14:13:52 +03:00
Megamouse 7d33ca7059 Qt: use QDateTime in update manager 2020-03-22 14:13:33 +03:00
RipleyTom af4efafae1 Remove Qt5Network Qt5OpenGL and Qt5QML dependencies 2020-03-22 13:48:43 +03:00
Megamouse 09a8974786 Qt: fix curl threads 2020-03-22 13:48:43 +03:00
RipleyTom b1d8bf754e Replace QNetwork operations with libcurl + wolfssl 2020-03-22 13:48:43 +03:00
Eladash 132c3e1c1a kernel explorer: Add information about memory containers 2020-03-22 12:41:02 +03:00
Eladash dc839e1784 lv2: Do not lose r3 data on syscalls
Allows to get the ID of the lv2 sync objects in the debugger by looking at r3's content.
2020-03-22 12:41:02 +03:00
Eladash f1cf62ac57 kernel explorer: Implement ability to view lwmutex owner 2020-03-22 12:41:02 +03:00
kd-11 12044bd8b0 rsx: Properly calculate vertex range when divisor is active
- The upper bound is to be rounded up, not down.
2020-03-22 10:57:47 +03:00
Eladash 01cafc042d cellSaveData: Ensure savedata_context members are 16-byte aligned
I saw stvx v128{0} (aligned 16-bytes store) usage on the first 16-bytes of CellSaveDataCBResult before funcStat in fw.
Also I saw 4 stw of u32{0} on it as well before funcFile, funcFixed and funcList.
So just add the resets for result before all callbacks, and make all
members of savedata_ontext 16 -byte aligned in case there are more
members guaranteed to be aligned.
2020-03-21 19:05:20 +03:00
Eladash ceaee0ec68 cellSaveData: Clear traces of setList setup from setBuf->buf, add missing memset
* Always memset 0 setBuf->buf (to bufSize) before funcStat if the direcory is not new.
* Always memset 0 setBuf->buf (to bufSize) if listGet->dirNum became non-zero (listGet->dirListNum can be zero yet memset still occurs) .
* Clear traces of setList setup before funcStat (after funcFixed/List, only if listGet->dirNum != 0, callback can hack this value and prevent the memset).
2020-03-21 19:05:20 +03:00
Eladash b6a288d383 cellSaveData: Skip directory items in savedata_get_list_item 2020-03-21 19:05:20 +03:00
Eladash ae14eb0747 Minor fix of cellUserInfoGetStat
stat == nullptr is allowed, fix invalid id error code.
2020-03-21 19:05:20 +03:00
Eladash be0e586671 cellSaveData: Add error checks for cellSaveData(User)GetListItem 2020-03-21 19:05:20 +03:00
Eladash 66916df4ae cellSaveData: Set listSet->focusPosition to LISTHEAD by default 2020-03-21 19:05:20 +03:00
Eladash fae46bf194 cellSaveData: Add CELL_SAVEDATA_ERROR_NOUSER 2020-03-21 19:05:20 +03:00
Eladash e1cb827488 PPU Precise: Fix FMADDS, FMSUBS, FNMSUBS, FNMADDS 2020-03-21 16:32:09 +03:00
Eladash 3a36b713ce Dont spam syscalls stats if emu is paused 2020-03-21 16:31:18 +03:00
Nekotekina 49d8731c1c Thread.h: fix warning 2020-03-21 13:49:41 +03:00
Nekotekina ad552c6b78 Appveyor: use previous VS 2019 image (workaround) 2020-03-21 13:20:49 +03:00
Nekotekina ebb007ecb4 Update llvm hash 2020-03-21 12:38:16 +03:00
Eladash 9acf8e283d Fix OSK thread exit condition 2020-03-21 12:37:29 +03:00
Nekotekina 7f5dd1dd62 Fix thread_base::join 2020-03-21 10:36:04 +03:00
Nekotekina c577bd2111 Implement thread_state::errored
State after calling thread emergency_exit() function.
Also default-construct thread result in this case.
2020-03-20 21:31:27 +03:00
Megamouse eb2dcaf602 Qt: fix some translation bubus 2020-03-20 01:43:08 +01:00
Megamouse fd8cda0f2b overlays/osk: fix selection after changing panels
We now try to keep the current x and y selected after panel changes.
Also change some copy to ref
2020-03-19 21:10:08 +01:00
Megamouse c63f77e3b0 overlays/osk: fix full width characters 2020-03-19 21:10:08 +01:00
Megamouse a1f70bf96e overlays/osk: do not change the preview text on empty input
This prevents that the placeholder disappears
2020-03-19 21:10:08 +01:00
Megamouse f1127f1894 overlays: implement osk panels 2020-03-19 21:10:08 +01:00
Zion Nimchuk 27367dc493 Fix clang warnings 2020-03-19 19:20:27 +03:00
Zion Nimchuk 5ba07ed50f Partially revert 6ec149d. Fixes #7799
Turns out linking with LTO still doesn't play nice with Qt.
For reference:
https://github.com/InBetweenNames/gentooLTO/issues/444
https://bugreports.qt.io/browse/QTBUG-61710
2020-03-19 19:20:27 +03:00
Eladash 1dbb5422a2 Avoid a segfault when reading ppu stack contents in debuggers
TODO: lock vm mutex.
2020-03-19 14:18:05 +03:00
Eladash a3289e9d40 Fix memory leak in rsx debugger 2020-03-19 14:18:05 +03:00
Eladash f2d6a1ff60 disasm: Improve instructions spacing 2020-03-19 14:18:05 +03:00
Eladash fd45bf5fba debugger: Force aligned memory view
Fixes a corner case viewing unaligned memory at the end of spu memory.
Also unaligned view isn't suitable for the debugger, for these purposes the memory viewer should be used instead.
2020-03-19 14:18:05 +03:00
Eladash e3668cc26c Fix a segfault in memory viewer
Also a memory leak.
2020-03-19 14:18:05 +03:00
Eladash 7139c4fbab Fix bug introduced by #7797 2020-03-19 07:22:05 +03:00
Malcolm Jestadt 0bfdc1f62e PPU LLVM: Improve VMADDFP and VNMSUBFP
- Use native FMA to emulate VMADDFP, with a fallback for processors that don't support FMA
- Use native FMA to emulate VNMSUBFP as well, but note that it differs from the emulated path with regards to negative zero
2020-03-19 06:47:16 +03:00
Eladash b11e8f8b8d Minor fix of sys_ppu_thread_yield return value
Account for a special case where threads were rotated but no context
switch was made.
2020-03-19 06:45:14 +03:00
Eladash 7be35315da Fix lv2 sys_lwcond/sys_lwmutex kernel explorer names 2020-03-19 06:45:14 +03:00
Nekotekina aa5c6c4d2b Cleanup std::is_pod usage (deprecated in C++20) 2020-03-18 18:28:46 +03:00
Nekotekina 6a2571d0e1 SPU: print current chunk hash in dump 2020-03-18 18:28:46 +03:00
Nekotekina 20f7544a8a SPU profiler: minor change
Use std::greater to sort
2020-03-18 18:28:46 +03:00
Zion Nimchuk 6ec149d8f5 Build rpcs3's AppImages with link time optimization
On the clang build we now link with lld, and on GCC we now link with Gold
2020-03-18 13:07:44 +03:00
Zion Nimchuk 2678ac6382 Change default audio backend on non-windows
FAudio is preferred, but if we didn't build with FAudio, we default to OpenAL
Also changed it to explicitly use xaudio backend on windows, rather than the static cast we had before.
2020-03-18 09:38:13 +01:00
Eladash c9b5ba4a5c BEType.h: use common initial sequance in v128
Partially obey 'strict type aliasing' rule.
2020-03-17 18:22:13 +03:00
Eladash 03a6d67c6c Log sys_lwmutex/sys_lwcond names as strings
Use std::string_view instead of creating a temporary NTS string when reading object name.
2020-03-17 18:22:13 +03:00
Eladash a9f492b605 sys_spu: Fix oops in sys_raw_spu_destroy after #7782
'id' is not the idm id, also explicitly join the thread so a situation where the thread is still active and communicating other threads (e.g via MMIO or MFC) yet its ID is removed won't happen. (logic breakage, destroyed thread can't be  active)
2020-03-17 18:22:13 +03:00
Eladash 664d606123 Add return value of sys_ppu_thread_yield 2020-03-17 18:22:13 +03:00
Eladash 00d25a191b lv2: Uncomment sys_ppu_thread_stop/restart 2020-03-17 18:22:13 +03:00
Eladash 3566faabd9 Add missing lv2_obj::sleep when joining interrupt thread 2020-03-16 21:06:33 +03:00
Eladash 7e224c5585 cellVdecClose: Followup fix to #7663
Avoid executing sys_interrupt_thread_disestablish on different ppu thread with the same ID.
2020-03-16 21:06:33 +03:00
Eladash 9e14e835e7 Fix sys_raw_spu_destroy 2020-03-16 21:06:33 +03:00
Megamouse 33d01fd252 log: properly escape all html except newlines 2020-03-15 20:41:24 +03:00
kd-11 d25ba03e82 vk: Lazy evaluate renderpass scope
- Spamming the driver with renderpass open/close cycles is bad for performance.
2020-03-15 18:39:40 +03:00
kd-11 7025985c0d rsx: Improve section scanning when updating surface cache resources in blit engine. 2020-03-15 16:51:23 +03:00
kd-11 a756c0679e rsx: Implement cross-aspect slice gathering
- Fixes a data leak that can happen when a surface is rejected due to aspect mismatch.
- Mismatch can lead to rejection due to area covered excluding the RTT and inevitable upload a texture from CPU at the same location.
- Overlapping fbo/shader_read resources are not allowed.
2020-03-15 16:51:23 +03:00
Eladash 377e06a4a2 rsx: Fix unknown Blend equation 2020-03-15 09:53:15 +03:00
Nekotekina a0612ff4a7 Disable failing OSX build on travis
Since we have Azure maybe someone will have better luck with it.
2020-03-14 23:07:40 +03:00
Nekotekina 11d5bd3452 Try to re-enable Azure Pipelines for PRs 2020-03-14 22:50:17 +03:00
Rose 231e837f9b [UI] Grey out AA and Aniso settings under strict rendering (#7773)
* Grey out AA and aniso under strict rendering

* Сhange aniso UI string to 'Auto'

Co-authored-by: Ivan <Nekotekina@users.noreply.github.com>
2020-03-14 20:45:41 +03:00
Nekotekina 45389dca51 PPU: minor fix for ppu_join_status::max
Don't treat it as special "invalid" value.
2020-03-14 20:36:56 +03:00
Eladash 4e6934c9dc Minor idm::remove_verify usage optimization in sys_interrupty.cpp
Avoid copying a shared ptr, create a weak ptr instead.
2020-03-14 19:26:37 +02:00
Eladash 74c05ec5ee PPU Disasm: Fix non-link extended BCCTR forms 2020-03-14 19:26:22 +02:00
Eladash cb4192bce9 vm: Log all guest memory bases at startup 2020-03-14 18:30:14 +02:00
Eladash 83a2204f87 PPU Disasm: Fixup BCCTR after #7775 2020-03-14 18:30:14 +02:00
Eladash c16124f0d9 idm: Fix minor race in cellVdecClose, sys_raw_spu_destroy...
Because of racing removal of IDs vs the shared pointer owned object
2020-03-14 18:30:14 +02:00
Eladash efe6e1eb0a sys_ppu_thread: Make PPU id removal after exit atomic with descheduling
* Make PPU id removal after exit atomic with descheduling
* Make joining thread scheduling atomic with thread exit sleep.
* Update sys_ppu_thread_stop/restart.
* Add idm::remove_verify.
2020-03-14 18:30:14 +02:00
Eladash c3d36940c7 cellSaveData: do not allow to read/write/delete system files in funcFile
Return param error 70 as realhw in this case.
2020-03-14 16:12:18 +03:00
Eladash ff341fe597 PPU Disasm: Fix branches spacing
Null terminator was added at the end which prevented proper spacing.
2020-03-14 16:12:18 +03:00
Eladash db71d4852a cellSaveData: Fix adding file entries to PARAM.SFO on error 2020-03-14 16:12:18 +03:00
Eladash 88ee198d78 cellSaveData: return ERROR_FAILURE on funcFile deletion failures 2020-03-14 16:12:18 +03:00
Nekotekina 9176ca084c VFS: clarify escape/unescape cannot work on paths
With recent changes, it can only work with file or directory name.
2020-03-14 16:01:55 +03:00
Nekotekina 70cd8afafa VFS: improve vfs::escape (escape NUL, LPT, COM...)
Windows legacy trash.
2020-03-14 15:07:59 +03:00
Nekotekina 6a8f5e6b38 VFS: fix vfs::get
Escape each path element separately.
2020-03-14 14:25:37 +03:00
Nekotekina 6c234b48ce VFS: Fix possible out of range in vfs::escape 2020-03-14 13:33:25 +03:00
Nekotekina bf957a575c VFS: fix out of range problem in vfs::unescape
Also improve unescape with "!" allowing any character
2020-03-14 13:15:46 +03:00
Nekotekina 0c65a1721d VFS: escape multidot names like ... 2020-03-14 12:34:28 +03:00
Eladash 5d78d81c00 cellSaveData: Filter directory lists to allowed savedata directories
Filters "." and "..", as well as possible wrong directories added by the user.
2020-03-13 22:43:27 +03:00
Eladash b21b4faca8 cellSaveData: Fixed savedata lock after fmt::throw_exception 2020-03-13 22:43:27 +03:00
Eladash d58f52ff31 cellSaveData: Add some listSet error checks
* Check listSet->fixedListNum.
* Check listSet->fixedList for nullptr and its directory items names.
* Check listSet->focusDirName for nullptr and directory name.
* Check listSet->newData->iconPosition.
* Check listSet->newData->dirName for nullptr and directory string.
* Check statSet->setParam->parental_level for old sdk.
* Return an error if listSet->focusPosition is NEWDATA and listSet->newData is nullptr.
* Simplify savedata directory list selection.
2020-03-13 22:43:27 +03:00
Eladash 54af8ec544 cellSaveData: funcFile fixes
* Allow '_' at filenames start and extension.
* Check if reading offset is valid, fix error code to CELL_SAVEDATA_ERROR_FAILURE.
* Don't create empty file on error of write ops.
* Don't allow "." and ".." filenames on funcFile, return CELL_SAVEDATA_ERROR_BROKEN.
2020-03-13 22:43:27 +03:00
Eladash fdf47f43d8 cellSaveData: refactor param error 70 checks
Also extend the check to check empty name.
2020-03-13 22:43:27 +03:00
kd-11 2ae83782e1 vk: Fix potential MTRSX deadlock in case of a race condition 2020-03-13 22:06:04 +03:00
Eladash f3877d11e8 rsx: Fix initial boolean state of m_textures_dirty and m_vertex_textures_dirty 2020-03-12 21:36:43 +01:00
Eladash 28e9cade2c GUI/rsx capture: Disable capturing if no game is running! 2020-03-12 21:36:43 +01:00
Eladash c04abac630 rsx capture: Fix exceptions handler, fix tiny race condition on capture new capture 2020-03-12 21:36:43 +01:00
kd-11 7e9dbeff7b vk: Fix MTRSX deadlock (#7766) 2020-03-12 22:29:58 +03:00
Megamouse f0edcc16fe evdev: add more buttons to button list 2020-03-12 19:43:52 +01:00
Megamouse e7adef9fe1 evdev: remove unused call to update_device 2020-03-12 19:43:52 +01:00
Megamouse 9c5da55dca evdev: Some random cleanup 2020-03-12 19:43:52 +01:00
Nekotekina d802b3d8b2 Remove -fno-strict-aliasing
It was added due to miscommunication.
2020-03-12 16:04:57 +03:00
Nekotekina 04dedb17eb Disable exception handling.
Use -fno-exceptions in cmake.
On MSVC, enable _HAS_EXCEPTION=0.
Cleanup throw/catch from the source.
Create yaml.cpp enclave because it needs exception to work.
Disable thread_local optimizations in logs.cpp (TODO).
Implement cpu_counter for cpu_threads (moved globals).
2020-03-12 16:03:08 +03:00
kd-11 47bbfdd2aa vk: Change texture cache memory management for disposed textures
- Use global resource manager instead of using the 2-frame hold behavior.
- Fixes high VRAM usage in some games
2020-03-11 16:29:34 +03:00
Nekotekina 6bd96a4590 Fix thread_base::finalize (and emergency_exit, collaterally)
Forgot to reset futex callback. Could cause crashes.
2020-03-10 23:23:32 +03:00
Nekotekina 92eeec39b7 Improve Stop Watchdog
Make it less possible to interfere with the debugger.
2020-03-10 23:00:23 +03:00
Nekotekina 656db6c668 Fatal errors: concatenate multiple args after --error
It should fix error dialogs on Windows since it decomposes the arg string.
2020-03-10 22:42:33 +03:00
kd-11 7989de9d16 vk: Properly release dma resources. 2020-03-10 22:02:02 +03:00
Megamouse 3ea94c286b input/overlays: fix premature pad interception removal
shader compilation and trophy notifications shouldn't cancel the pad interception during proper dialogs
2020-03-10 19:04:32 +01:00
Bird Egop 4e25daffa6 Explicitly rename has_512 into has_avx512 (#7751) 2020-03-10 19:21:00 +03:00
Nekotekina b4f416cb76 Fix narrow warning in ds4_pad_handler.cpp 2020-03-10 18:45:49 +03:00
Nekotekina 1678b37aa0 Use TRAP on segfault with debugger (Linux) 2020-03-10 14:06:06 +03:00
Nekotekina adfd8ab43c Break in the debugger in thread_ctrl::emergency_exit
Implement IsDebuggerPresent analog for non-Windows systems.
2020-03-10 13:28:24 +03:00
Nekotekina 87d4b14ca9 Pause only on fatal messages
Also make some access violation an error since we don't pause on it.
2020-03-10 11:26:42 +03:00
Nekotekina d3eb267ba9 Logs: add 'always' method for debugging 2020-03-10 11:23:56 +03:00
kd-11 12b73c8bdc rsx: Fix copypasta 2020-03-09 17:20:24 +03:00
Eladash 5751b77688 GUI: followup to #7347
Show "Reboot" on current running game when there's no config.
2020-03-09 16:07:14 +03:00
Eladash 636ed4a48b HLE cellGcmSys: Avoid calling sys_rsx syscalls in rsx code 2020-03-09 16:07:14 +03:00
Eladash af7cdcb5c7 Add forgotten error check in sys_spu_thread_group_connect_event 2020-03-09 16:07:14 +03:00
kd-11 2985a39d2e rsx: Rewrite async decompiler 2020-03-09 14:59:25 +03:00
Nekotekina 609c0d46af Implement stop watchdog
Shows fatal error if stopping takes more than 5s.
2020-03-09 13:20:49 +03:00
MSuih a2b6546d37 Fix framelimit/aspect ratio width 2020-03-08 21:56:48 +01:00
Nekotekina 9dca2887d8 Fixup for Emu.Pause()
Remove some reduntant calls.
Don't pause on unknown sys_fs_fcntl operation.
2020-03-08 22:03:16 +03:00
Nekotekina 6268a2d384 Improve report_fatal_error()
Previously it could cause secondary segfault on Linux.
2020-03-08 22:03:15 +03:00
Nekotekina c87beaa694 Use _wexecl on Windows
Allows original path to contain any Unicode character.
2020-03-08 20:45:34 +03:00
Nekotekina 1bbe2e9b15 Simplify report_fatal_error
Those semaphores didn't achieve anything.
Launch separate process if Qt is already initialized.
2020-03-08 20:45:34 +03:00
Nekotekina e40019354c Pause emulation on any fatal log message. 2020-03-08 20:45:34 +03:00
Nekotekina 07e1766a7c Implement thread_ctrl::emergency_exit()
Replace exception throws with this.
2020-03-08 15:11:02 +03:00
illusion0001 814c73407d overlay: set minimum update interval to 1ms 2020-03-08 15:05:42 +03:00
Eladash 5692c3de04 Fix sceNpUtilCmpNpId 2020-03-08 12:49:34 +03:00
kd-11 8214425a3c rsx: Fix framebuffer native layout for X32_FLOAT
- It was not matching the order laid out for normal textures uploaded from CPU.
2020-03-08 11:43:49 +03:00
kd-11 84a542fbce rsx: Blit engine improvements
- Detect writes to the display output memory and handle it specially.
  It already defines a known 2D region.
- Try and detect situations where raw transfers would be of benefit.
2020-03-08 10:30:13 +03:00
Megamouse ab4189998c Qt: don't create stupid default.ini file when resetting gui configs 2020-03-08 00:06:48 +01:00
Megamouse 9b672cb969 Qt: Improve tooltip areas in network tab 2020-03-08 00:06:48 +01:00
Megamouse 5f247cbedc Qt: Backup current gui config before applying another one
Also fixes some strange issues caused by the pointer
2020-03-08 00:06:48 +01:00
Megamouse 53676067fc Qt: remove gui settings default shenanigans 2020-03-08 00:06:48 +01:00
Megamouse 11bc7de0ca Qt: more code cleanup in gui files 2020-03-08 00:06:48 +01:00
Megamouse 091dcc1052 Qt: fix play button state when booting rpcs3 for the first time 2020-03-08 00:06:48 +01:00
Megamouse 934a2eb9fa Qt: some code cleanup in gui files 2020-03-08 00:06:48 +01:00
Megamouse 426643c44d Qt: Prefer currently selected game when pressing the play button
Also rename Start to Play
2020-03-08 00:06:48 +01:00
Megamouse 7dd36ff829 Qt: Fix CurrentSelectionIconPath for game grid
Fixes deselection issue when booting a game in the game grid
2020-03-08 00:06:48 +01:00
Megamouse 0c45457101 Qt: Add title and title id to button tooltips 2020-03-08 00:06:48 +01:00
Megamouse e56b3256b0 Qt: Add missing boot error dialog 2020-03-08 00:06:48 +01:00
Eladash 892f74d762 rsx: Improve frame-limiter (#7723)
* rsx: Improve frame-limiter accuracy

* lv2: Improve lv2_obj::wait_timeout response time for aborting threads

* rsx: Make stretch to display area setting dynamic

* rsx: Redefine 'auto' frame limiter to obey vblank rate

* rsx: Make frame limiter setting dynamic

* rsx: Make frame-limiter compatible with dynamic changes
2020-03-08 01:11:35 +03:00
Eladash deb6bd3e25 Atomic sys_prx_load_module_list error checks 2020-03-07 22:03:38 +03:00
Eladash 5e86ef2371 rsx: Make force cpu blit setting dynamic 2020-03-07 21:17:26 +03:00
Nekotekina e74d3c2674 Fix llvm_build.vcxproj instructions 2020-03-07 18:34:04 +03:00
kd-11 149d550f7e gl: Restore commented out line
- Byte order step was disabled for debugging and not restored
2020-03-07 17:23:25 +03:00
kd-11 70f2577b9e vk/gl: Use best-fit semantics when scanning texture cache for flippable images
- Allows sourcing flip data from the blit engine resources which avoids expensive flush and re-upload
2020-03-07 16:58:35 +03:00
kd-11 93295f7f50 vk: Fix image properties for flip temporary images to be samplable.
- In case of gamma correction or other effects, they may require shader access.
- BGRA8_UNORM is usually safe to use directly without staging memory.
2020-03-07 16:58:35 +03:00
kd-11 1725f7a34b rsx: Add anaglyph 3D filter 2020-03-07 16:58:35 +03:00
kd-11 6e3406b3f5 video: Allow selection of 3D stereo resolutions 2020-03-07 16:58:35 +03:00
Nekotekina 19107b2de5 logs.cpp: fix log format for backward compatibility
Don't add prefix for first messages.
2020-03-07 15:33:07 +03:00
Nekotekina 7599c66639 logs.cpp: print some errors if failed to create logs 2020-03-07 14:38:19 +03:00
Nekotekina b726aa5a3e logs.hpp: minor optimization for non-formatting logs
Also use single template with CharT to match fmt::format.
2020-03-07 13:52:51 +03:00
Nekotekina 12a3cdf0e8 Move Log.cpp to util/logs.cpp
Minor cleanup
2020-03-07 13:31:10 +03:00
Nekotekina e4a81b1d13 Move Log.h to util/logs.hpp 2020-03-07 12:29:23 +03:00
Nekotekina a166d3680e Don't throw on invalid whence (return fs::error::einval) 2020-03-07 11:52:54 +03:00
Nekotekina 8461a5cbe2 Add fs::error::unknown, don't throw 2020-03-07 11:22:04 +03:00
Nekotekina 66b0b78055 Logs.cpp: more code moved to main.cpp 2020-03-07 11:15:44 +03:00
Nekotekina 2209be5216 Logs: remove mem-mapped buffer and move instance lock to main.cpp
Part of the work to untangle utilities from RPCS3-specific things.
2020-03-07 10:49:09 +03:00
Eladash 1669e95870 Implement lv2_file::open()
Return accurate error codes in prx_load_module, sys_spu_image_open and overlay_load_module.
2020-03-06 21:16:46 +03:00
Nekotekina acd50eefaf Try to use designated initializers 2020-03-06 09:42:49 +03:00
Nekotekina 7514e53385 Fix SPRX/firmware installation (use a mutex) 2020-03-06 08:39:24 +03:00
Megamouse e1b4cf1557 Qt: Fix led dialog layout and use hidpi painting 2020-03-05 22:37:48 +01:00
Megamouse 9e449db0c2 Qt/Input: piggyback on existing callback for battery_level
removes ds4 timer workaround
2020-03-05 22:37:48 +01:00
Adiost f776910966 Qt/Input: new ds4 LED settings 2020-03-05 22:37:48 +01:00
Megamouse 0361184930 Fix llvm link 2020-03-05 20:33:44 +03:00
Eladash f6cf36f6a7 Fix _sys_prx_get_module_info p0pt->filename writing with 0 size 2020-03-05 18:28:56 +03:00
Nekotekina 7a8772dafa Replace std::string::npos with umax 2020-03-05 14:05:23 +03:00
Nekotekina 0a41999818 PPU LLVM: fix regression from warning fixes
Forgot that negative power is used here.
2020-03-05 11:07:40 +03:00
Megamouse f1147f70f4 Fix 7z for Debug and Release 2020-03-04 23:58:16 +01:00
Eladash 39eafc1f3b Fix Crypto/utils.cpp: extract_file_name 2020-03-05 00:31:43 +03:00
Megamouse 21b6495aaa Fix ui and sys_net warnings 2020-03-04 22:28:05 +01:00
Nekotekina Aux1 250736ece5 Fix warnings in emucore 2020-03-04 21:23:34 +03:00
Nekotekina Aux1 f2f3321952 Fix warnings in VKGSRender 2020-03-04 21:23:34 +03:00
Nekotekina Aux1 c3f3451269 Fix warnings in GLGSRender 2020-03-04 21:23:34 +03:00
kd-11 54775d91dc rsx/blit-engine: Account for a rare corner case
- It is possible to have a RTV<->DSV transfer with compatible-sized formats.
  Mark the depth size as typeless in such a situation to avoid crossing the aspect barrier with the API.
2020-03-04 21:21:59 +03:00
RipleyTom f1f5c91386 Fake PSN (#7516) 2020-03-04 13:55:35 +00:00
Eladash bb1b4bac9b Update thread_base::notify_abort() 2020-03-04 14:39:41 +03:00
Nekotekina bdbc7b5f1d PPU: use named_thread_group to compile modules
Improves internal logic by not using too many threads.
2020-03-04 14:10:38 +03:00
Nekotekina 8d847d6f1c Thread: internal cleanup
Use different, simpler algorithm in wait_for.
Although the very idea of such notifications was rotten.
2020-03-03 20:26:37 +03:00
Nekotekina d594490329 Thread: removed unused wait() with predicate.
It doesn't work this way anyway.
2020-03-03 18:33:02 +03:00
Nekotekina 6c66153372 Threads: move linux m_timer to static thread_local variable
Allows lazy allocation of the timer handle.
2020-03-03 18:33:02 +03:00
Nekotekina 5b0476e772 Update LLVM to new llvm-mirror (LLVM 11)
Use clang-cl to build LLVM on Windows.
2020-03-03 18:33:02 +03:00
Nekotekina 68f50c7035 Fix ppu_syscall_usage thread waiting
Fixed 10s hang on exit
2020-03-03 18:33:02 +03:00
Eladash 5c3d417b35 Fix cellGameDataCheck's game data creation with PARAM.SFO set/get 2020-03-03 18:31:43 +03:00
Nekotekina 01db83bc36 SPU LLVM: Rewrite fma32x4 to match FM and older asmjit stuff 2020-03-03 11:31:20 +03:00
Eladash de1774d8f2 cellSaveData: fix doneGet->sizeKB (#7674)
* cellSaveData: fix doneGet->sizeKB

* [⚠️] Warning: beware of typos [⚠️]
2020-03-03 11:24:49 +03:00
Zion Nimchuk 0f1fd059fc Properly setup Azure Pipelines using current system
Also sets up Azure artifacts (including for PRs) for AppImages
2020-03-03 10:39:30 +03:00
JohnHolmesII 87c8d1800b Azure (#7673)
* Set up CI with Azure Pipelines
2020-03-03 01:55:05 +03:00
Nekotekina 3105b21909 Print PPU Syscall Usage Stats
* Every 10 seconds
* On normal exit
2020-03-02 20:48:20 +03:00
MSuih d94b875187 Minor cleanup
- Remove log prefix as auto-updater no longer uses general channel for logging
- Swap some C-style nulls for nullpointers
- Other misc changes
2020-03-02 12:31:59 +03:00
MSuih 7129902b25 Add time logging for updater
Might help diagnose issues
2020-03-02 12:31:59 +03:00
Nekotekina bd234a7668 sys_ppu: another fixup 2020-03-02 10:35:54 +03:00
Megamouse 73a9946212 Qt: remove game window title size restriction
- Elide game window title label
- Add tooltip with format and resolved title
- Remove max length (do not wrap text to show how ridiculous it will look if it's too long)
2020-03-01 22:00:57 +01:00
Nekotekina c7fa4e2375 Fixup 2020-03-01 22:40:48 +03:00
Nekotekina 6ee9153329 sys_ppu_thread: fixing detached threads 2020-03-01 22:29:03 +03:00
InvoxiPlayGames 752c4a7b0d Fix duplicate inputs for GHLtar strumming 2020-03-01 20:10:46 +03:00
kd-11 582c98359e videoOut: Resolve 'auto' aspect ratio
- 'Auto' is not an actual aspect ratio, just a dont-care flag to set the
  display to the best fit aspect ratio.
  Decay this option into a proper ratio for cellVideoOutGetState to
return legal values.
2020-03-01 20:10:11 +03:00
Eladash 7dfd50d5cc cellSaveData: followup to #7652 2020-03-01 20:09:46 +03:00
Nekotekina b05b16aedc sys_ppu: Hotfix for detached threads 2020-03-01 18:30:16 +03:00
Eladash ffd5a9e91c cellSaveData: Add some error checks for fixedSet, fileSet params 2020-03-01 10:56:41 +02:00
AniLeo fbe6900b28 rpcs3_version: Bump to 0.0.9 2020-03-01 00:17:15 +03:00
kd-11 7fe9802f87 vk: Properly use declared pitch when loading simple images 2020-03-01 00:16:52 +03:00
kd-11 14aebeac58 video-out: Allow applications to successfully change display resolution
- Avoids a situation where a game configures output correctly but gets back bogus information later when querying.
- Should fix games being broken at some resolutions but not others.
2020-03-01 00:16:52 +03:00
kd-11 76bbbe27f1 vk: Fix dma resource leak
- Fix broken check; a relic of the past where flush method would reset the fence
2020-03-01 00:16:02 +03:00
kd-11 9af52d12a8 vk: Improve events
- Make events properly managed objects.
- Add a workaround for AMD's broken event status query
2020-03-01 00:16:02 +03:00
kd-11 5eb314fbbb vk: Add execution barriers.
- Useful for debugging
2020-03-01 00:16:02 +03:00
Eladash 655f7ce8a2 cellSaveData: Add null funcStat check
it's ordered specially for some functions
2020-03-01 00:14:45 +03:00
Eladash c11074a128 RawSPU: fix race condition in RunCntl stop request 2020-02-29 21:54:54 +03:00
InvoxiPlayGames ef6854ca46 sys_usbd: Guitar Hero Live controller emulation (#7336)
* Initial GHLtar emulation

* Add GHLtar to CMakeLists and VS project, zero the buffer and remove unused header values

* Fix coding style issues and include headers

* Remove redundant if, improve code formatting

* Remove needless includes

Co-authored-by: Ivan <Nekotekina@users.noreply.github.com>
2020-02-29 21:40:44 +03:00
clienthax 7e590eaa2f Change key_vault to use version ranges. 2020-02-29 21:24:15 +03:00
MSuih 94478ad4a0 Add error for missing firmware 2020-02-29 21:19:01 +03:00
Nekotekina e28e51463b Compilation fix
Should fix #7642
2020-02-29 21:16:28 +03:00
Nekotekina cb252b1ce2 Partial revert of 5871c4e93f 2020-02-29 18:39:15 +03:00
Nekotekina d37e770497 Shut up all channels on exit at some point
Some object are getting destroyed.
Makes valgrind more quiet.
2020-02-29 18:29:32 +03:00
Eladash 5871c4e93f Segfault/exceptions reports: Get rid of unhandled exeption handler, log memory bases
* Getting rid of handled exception handler fixes 2 things:
- Visual Studio debugger won't force it's own handler on unhandled exception.
- SPU segfaults in recompiler can now be reported.

* Log vm memory bases.
2020-02-29 17:16:36 +03:00
Eladash 50f51be06a Improve sys_timer_get_information (#7638)
* Improve sys_timer_get_information

* sys_timer_disconnect_event_queue sets STATE_STOP regardless of port connection status.
* sys_timer_get_information sets 0 for period and next_expire if the timer is stopped.

* Fix two minor races in lv2_timer thread

* If the timer thread is about to fire an event of queue x, then another thread disconnects the queue, then restarts the timer and connects the event queue, then the timer thread sends an event - event data combination (source, data1, data2, next) may be inaccurate.

* If the timer thread is about to send an event (periodically), then another thread stops the timer and starts it again with sys_timer_start_periodic_absolute, timer.expire in info->timer_state in sys_timer_get_information may be inaccurate.
2020-02-29 17:15:25 +03:00
Nekotekina 8e5a03f171 Use named_thread_group in rsx_cache.h 2020-02-29 16:55:25 +03:00
Nekotekina f72971f19f Implement named_thread_group 2020-02-29 16:55:25 +03:00
kd-11 eb140c52a4 rsx: Reset ZCULL statistics at the end of a frame
- Workaround for games that leak zpass/zstats.
  The information is useless anyway without a clear op so it should be fine.
2020-02-29 14:23:52 +03:00
kd-11 198c84cabf rsx: Fix zcull clear command; do not clear ZPASS when ZSTATS is cleared. 2020-02-29 14:23:52 +03:00
Eladash 5a73943be6 Fix sys_timer_destroy
Also some cleanup.
2020-02-29 13:06:14 +03:00
Eladash 34a0c3f488 cellSaveData: Add error param 72, 73 checks for file write ops 2020-02-29 13:06:14 +03:00
Eladash 8762f2a588 Use more starts_with 2020-02-29 13:06:14 +03:00
Eladash d7dd4897f8 Allow 0x30000000 > addr >= 0x2000000 ppu loader exec allocations (workaround) 2020-02-29 13:06:14 +03:00
Nekotekina a84077f174 sys_ss: use BCryptGenRandom on Win32 2020-02-29 12:15:42 +03:00
kd-11 08f3460365 vk: Fixup for RCB/RDB in special cases
- Images must be in TRANSFER_DST_OPTIMAL or GENERAL layouts to call the image upload routines.
2020-02-29 12:13:11 +03:00
Nekotekina be0e4e9879 Move Progress Dialog Server to named_thread
Make it a global variable, but that can be actually destructed at exit.
2020-02-28 21:59:56 +03:00
Nekotekina 799c3f9708 Remove global thread counter (again)
Seems fine without it now.
2020-02-28 21:50:19 +03:00
Nekotekina 490f58ff3c Try to purge thread_state::detached
It's rarely necessary, but can cause unexpected problems.
2020-02-28 21:11:13 +03:00
kd-11 cb047fcc75 rsx: Disable zstat checks to avoid unnecessary stream splitting (#7624) 2020-02-28 20:27:31 +03:00
Nekotekina ac2581659a RSXOffload: fix dma_manager::sync() freeze on exit
Its logic was completely broken.
2020-02-28 19:55:43 +03:00
Nekotekina f335d034fc Fix RSX Offloader thread exit (MTRSX fix)
Hangs on exit if MTRSX is enabled.
2020-02-28 19:43:42 +03:00
Eladash 05bb6e1545 Improve sceNpDrmVerifyUpgradeLicense(2), sceNpDrmIsAvailable(2)
* sceNpDrmVerifyUpgradeLicense(2): copied string from content_id is 47 chars in length at max, is no null term was found it forces string termiation.
* sceNpDrmIsAvailable(2): Same with drm path just that it's 256 chars at max.
2020-02-28 19:10:39 +03:00
Nekotekina 65eeee0f4c Remove cancerous lf_value<>
Replace thread names (generic, PPU, SPU) with new shared pointers.
Devirtualize cpu_thread::get_name (used in single case).
2020-02-28 18:54:46 +03:00
Nekotekina bf4bdf73b7 Remove unused lf_hashmap
There are better ways to implement this.
2020-02-28 18:54:46 +03:00
Eladash 30f7c81cc5 cellSaveData: Implement/Fix param error 22 for funcFile, funcDone, funcFixed and funcList 2020-02-28 16:47:51 +01:00
Nekotekina 08ab9c4b04 fixed_typemap.hpp: reset creation index to avoid confusion 2020-02-28 00:16:04 +03:00
Nekotekina 4474757162 fixed_typemap.hpp: remove <algorithm> dep in header
Create fixed_typemap.cpp
2020-02-28 00:04:37 +03:00
Nekotekina bacd1698fc fixed_typemap.hpp: minor cleanup 2020-02-27 23:04:23 +03:00
Ivan e133c7a7dc Merge pull request #7506 from elad335/patch-1
PPU exec/ovlm ldr: restrict allocations
2020-02-27 22:55:30 +03:00
Eladash 0eabfdcadd cellSavedata: reset padding of g_savedata_context 2020-02-27 22:31:31 +03:00
Eladash d86241bbcd cellSaveData: reset fileSet and fileGet->reserved everytime 2020-02-27 22:31:31 +03:00
Eladash 42a0512c66 cellSaveData: Avoid passing vm pointer to native API 2020-02-27 22:31:31 +03:00
Eladash 556aba46b5 cellSaveData: do not fail on empty directory 2020-02-27 22:31:31 +03:00
Stephen McKinney 2b853cc8bc Don't improperly resolve symlinks when booting games. 2020-02-27 22:30:11 +03:00
JohnHolmesII 00b74fb951 Update BUILDING.md and CMakeLists.txt
Several parts of the guide had fallen out of sync, notably the Ubuntu section. I've tried to clean it up a bit.
In addition, I matched some of the version numbers to what is found in the CI system here: https://github.com/hcorion/rpcs3-docker/blob/master/xenial/Dockerfile
2020-02-27 21:31:43 +03:00
Nekotekina ecd68dfc70 overlays: add "thread bits" to wait on and avoid lockup
Add TLS variable to store its own bit.
2020-02-27 19:14:08 +03:00
Nekotekina d0b2eecc9a fixed_typemap.hpp: polish move constructor a bit
GitHub, plz.
2020-02-27 19:14:08 +03:00
Nekotekina d5c85f308a fixed_typemap.hpp: forgot destructor 2020-02-27 13:04:12 +03:00
Nekotekina f71cdb4eb8 g_fxo: implement logging for object creation/destruction.
Only logged at automated phase for initial/final processing.
2020-02-27 13:04:12 +03:00
Megamouse ee46ad1ca9 move overlays code to headers 2020-02-26 23:43:18 +01:00
gamerforEA 762c106e19 sys_prx_.cpp: Fix RAII locks usage (without local variables they destroyed immediately after construction) 2020-02-27 00:38:55 +03:00
gamerforEA 93552a5958 Apply some Clang-Tidy fixes 2020-02-27 00:38:55 +03:00
gamerforEA c0fbf3091e Remove unnamed namespaces from headers 2020-02-27 00:38:55 +03:00
gamerforEA 49294a3dd2 Add missing include guards 2020-02-27 00:38:55 +03:00
RipleyTom abfa303e07 Auto-updater minifix 2020-02-26 22:06:58 +03:00
Nekotekina 5094ab8283 Fix RSX Offloader thread name 2020-02-26 21:57:01 +03:00
Nekotekina a0d2bc9769 named_thread: allow default constructor only with thread_name
In C++20, lambdas may be default-constructible allowing nasty stuff.
2020-02-26 21:23:30 +03:00
Nekotekina e102dc2a94 Add message on exit if some thread are still waiting 2020-02-26 21:23:30 +03:00
Nekotekina 5e59f18720 fixed_typemap: implement need<> method
It may be used in constructors of other objects to assert a dependency.
It also helps to ensure reverse destruction order of that dependency.
2020-02-26 21:23:30 +03:00
Nekotekina b35a5982e8 Fix one bug with MsgDialog thread (freeze on exit)
Forgot to check thread state
2020-02-26 21:23:30 +03:00
Eladash 4d3cdca7f6 Stub sys_spu_thread_group_set_cooperative_victims and syscall_253 2020-02-26 18:17:13 +00:00
Eladash 0d4f8ca234 fs: Make fs::get_dir_size able to report an error 2020-02-26 18:17:13 +00:00
kd-11 569e1c2df6 rsx: Fix typo. Noted by github user @gamerforEA 2020-02-26 19:40:35 +03:00
kd-11 6e9392fb45 rsx: Restructure ZCULL query triggers
- Both ZCULL stats and ZPASS stats require hardware queries, but
  ZCULL stats should not contribute to ZPASS stats and vice versa!

- Disables hardware queries for ZCULL stats by themselves, we cannot
  generate them correctly anyway and no game so far has been found to
  actually use them. Should lessen the load on the backend for games
  that do not actually require it.
2020-02-26 19:40:35 +03:00
Nekotekina df1813b4e2 overlays: hotfix for waiting on thread_count 2020-02-25 23:43:05 +03:00
Nekotekina ff16e678a5 Add thread_count instead of former thread pool 2020-02-25 23:16:55 +03:00
Nekotekina 982856e70d overlays: remove unused threadpool 2020-02-25 22:56:50 +03:00
Nekotekina 144c20649f Try to fix msg dialog breakage 2020-02-25 22:50:44 +03:00
Megamouse e719bcf338 overlays: add layer modes to osk 2020-02-25 21:57:49 +03:00
Megamouse 3f4226b70e overlays: Fix find and replace regression 2020-02-25 21:57:49 +03:00
Megamouse 620cfd5063 overlays: move code to overlay_utils.cpp 2020-02-25 21:57:49 +03:00
Megamouse 69b2e746fa overlays: fix overlay_utils.h filter 2020-02-25 21:57:49 +03:00
Megamouse 2341749485 overlays: add overlay_osk.h 2020-02-25 21:57:49 +03:00
MSuih 33abcf74f2 Add information about boot process 2020-02-25 19:42:20 +03:00
Nekotekina 4e33ae319b fixed_typemap.hpp: minor fixup 2020-02-25 18:27:05 +03:00
Nekotekina b083edccd3 Threads: remove some unused code (remnants from thread spawn) 2020-02-25 15:57:57 +03:00
Nekotekina b59bb16fad Threads: removed outdated on_abort detection deemed unnecessary
May cause regressions.
2020-02-25 15:48:25 +03:00
Nekotekina 3f943945a7 Threads: Remove unused on_wait() detection to simplify code 2020-02-25 15:36:08 +03:00
Nekotekina 136d769895 Fix g_fxo->init internal logic for CTAD (use () not {})
Also improve comments to the functions.
2020-02-25 14:34:06 +03:00
Nekotekina 9c9c2eb2c9 Fix wrong g_fxo->init_crtp name, use just init<> 2020-02-25 14:07:50 +03:00
Nekotekina 318a364d09 Try to fix OSK 2020-02-25 14:03:13 +03:00
Nekotekina fa02a04baa Add g_fxo->init_crtp to simplify thread construction 2020-02-25 11:51:41 +03:00
Nekotekina 7eebe06931 Restore thread counter (world may be not ready yet)
Remove dumb 1300ms timeout.
2020-02-25 11:51:19 +03:00
kd-11 cd40bc8c61 overlays: Avoid race condition between rendering and layout operations for system widgets
- System widgets are callable from outside RSX code.
- Responding to draw requests while setup is in progress can cause malformed cached output
- Fixes glitched layouts for system message dialogs
2020-02-24 23:33:47 +03:00
kd-11 f6ebd88687 overlays: Ditch wstring for u32string
- Turns out wstring is not the same as u32string on windows.
2020-02-24 23:33:47 +03:00
MSuih 13ef0cc8c4 Fix native UI tooltip 2020-02-24 19:45:16 +01:00
MSuih df5059b142 Change logging level for invalid disc path 2020-02-24 19:45:16 +01:00
Megamouse f7666f44da Untangle GUI and input includes 2020-02-24 16:31:01 +01:00
Megamouse 7b49249f5f Input: Add config lerp factor for buttons and triggers
Adds new lerp factors to the keyboard pad handler In order to simulate triggers and analog buttons.
See "Analog Button Lerp Factor" and "Trigger Lerp Factor" in the yml in InputConfigs/Keyboard/.
Values Range from 0-100 as before, where 100 is instant press and 0 is never.

Currently I'm not planning any GUI element for this.
2020-02-24 08:56:57 +01:00
Megamouse 64ed2f1151 Input: use std::lerp instead of lerp template 2020-02-24 08:56:57 +01:00
Megamouse 17f335648c Input: misc updates to some functions in PadHandler 2020-02-24 08:56:57 +01:00
Nekotekina 1dc2eb1cc8 Avoid deprecated av_register_all with version check. 2020-02-23 20:58:02 +03:00
Emmanuel Gil Peyrot 1a702de9e4 cellVdec: replace deprecated ffmpeg function
avcodec_decode_video2() is deprecated, now replaced with
avcodec_send_packet() and avcodec_receive_frame().
2020-02-23 20:21:59 +03:00
Nekotekina f1241c572c Fix some deprecation warnings (plunder cellAdec btw) 2020-02-23 20:21:59 +03:00
Eladash 522daf5eac rsx: Fix NULL renderer 2020-02-23 19:57:55 +03:00
Nekotekina e772dde3cc Add more thread information (context switch, page faults).
Only implemented on Linux, possibly works on some BSD.
2020-02-23 16:21:26 +03:00
Nekotekina 8b4b859091 Remove "thread_ctrl::spawn" 2020-02-23 15:03:38 +03:00
Nekotekina 18db020b93 Fix warning in RSXOffload.cpp (rewrite thread) 2020-02-23 14:19:23 +03:00
Nekotekina 7069e7265f RSX: move g_dma_manager to g_fxo 2020-02-23 13:12:50 +03:00
Nekotekina fa0bf6a92c Fix "unknown pragma" on zlib clang workarounds 2020-02-23 10:42:35 +03:00
JohnHolmesII 758902382d AudioBackend.cpp: Implicit enum to float conversions are deprecated 2020-02-23 09:38:04 +03:00
JohnHolmesII cc71d2c4bf memory_string_searcher: Change to std strings
- Compiler warnings indicated that the call to toStdString() did not
   create an object that lived long enough be used. Simply use std
   string ahead of time.
2020-02-23 09:38:04 +03:00
JohnHolmesII 9b7d28b5dd cellSaveData.cpp: Use ref instead of copy 2020-02-23 09:38:04 +03:00
JohnHolmesII b9ee53d82a game_list_frame.cpp: Fix progress dialog constructor arguments 2020-02-23 09:38:04 +03:00
JohnHolmesII 479a64c4e8 Remove some inline compiler pragmas 2020-02-23 09:38:04 +03:00
JohnHolmesII 7b54d386f2 Set required Clang to 9
- 10 is not yet required and is not very available
2020-02-23 09:38:04 +03:00
JohnHolmesII 7eccbecb2f File.cpp: Make var ref instead of copy 2020-02-23 01:22:38 +01:00
Nekotekina 2bab3afae0 Fix deprecation warning in System.cpp 2020-02-22 19:41:03 +03:00
AniLeo fa3fde7a29 hle: Fix cellAvconfExt function registrations
Co-authored-by: Clienthax <clienthax@gmail.com>
2020-02-22 17:27:58 +03:00
AniLeo 3aa293a7a3 hle: cellAuthDialog
Basic RE of cellAuthDialog, stubs functions
2020-02-22 16:03:14 +03:00
RipleyTom 4befa36365 Use official libusb repo 2020-02-22 16:02:40 +03:00
Nekotekina 96be40bf30 Implement cellMsgDialog closing thread
Fixing deprecation warning.
2020-02-22 15:17:02 +03:00
Nekotekina 3001701059 Test: disable warning for "macro redefined" spam 2020-02-22 15:17:02 +03:00
kd-11 fa41297b27 overlays/trophy: Migrate to multibyte strings 2020-02-22 15:07:14 +03:00
kd-11 b8f51398b7 overlays/save_dialog: Migrate to multibyte strings 2020-02-22 15:07:14 +03:00
kd-11 cb2129c7e4 overlays/osk: Migrate to multibyte encoding 2020-02-22 15:07:14 +03:00
kd-11 703ec9f896 overlays: More unicode utilities 2020-02-22 15:07:14 +03:00
kd-11 19350d024b overlays: Font system improvements
- Add support for Hangul blocks (korean)
- Restructure font fallback system to allow the user to 'install' fonts if missing.
  Should allow fonts to work with no firmware on open systems like linux
2020-02-22 15:07:14 +03:00
kd-11 8e68427daf overlays: Add basic font substitution system and separate JPN from Latin-1 set
- Gets JP glyphs to render correctly, but the generalization may negatively affect other CJK glyph sets.
  PS3 doesn't seem to use other glyph sets much however.
2020-02-22 15:07:14 +03:00
kd-11 6220206cbc vk: Implement 2D array textures required for new font subsystem 2020-02-22 15:07:14 +03:00
kd-11 1df1ceb4ea gl: Support new glyph format with array textures 2020-02-22 15:07:14 +03:00
kd-11 6178a0ab25 overlays: Migrate to wide-char strings 2020-02-22 15:07:14 +03:00
Eladash 6bb083a77c Add more information for segfault reports (#7538) 2020-02-22 10:58:42 +00:00
Megamouse 171e6c6e54 Qt: remove duplicate paths in game list 2020-02-21 21:00:46 +01:00
Megamouse 313b967217 Qt: simplify blockingMap occurances 2020-02-21 21:00:46 +01:00
Megamouse b47a8b9995 Skip some logging in add_only Load 2020-02-21 21:00:46 +01:00
Megamouse c4a1c6f845 Do not reset PS3_GAME when booting disc patches 2020-02-21 21:00:46 +01:00
Eladash 24d3e2b2b8 cellGameDataCheckCreate(2): More improvements
* IsNewData is false only if PARAM.SFO exists.
* Don't create directory on error (setParam == nullptr && isNewData).
* Return CELL_GAMEDATA_ERROR_BROKEN if PARAM.SFO exists on target directory yet is not from GD category.
2020-02-21 21:15:55 +03:00
Nekotekina 145b80d262 Re-enable warning "macro redefined" (clang) 2020-02-21 19:36:05 +03:00
Nekotekina 5e75a0c497 Disable cotire on travis
Make some workarounds for clang because it poorly supports -Wold-style-cast
2020-02-21 17:03:54 +03:00
Nekotekina 972e0ab31d Remove -Wno-reorder and make it an error 2020-02-21 15:20:34 +03:00
Eladash 54f2c27ba0 cellGameDataCheckCreate(2): Set nullptr in setParam
* setParam is nullptr by default.
* if setParam is null and it's new data, return error code.
2020-02-21 14:49:45 +03:00
Eladash 0ba1f8f4ef Fix cellDiscGameGetBootDiscInfo on error
* Always set first dword to 0, other bytes are untouched,
2020-02-21 14:49:45 +03:00
Eladash 4d7e53d7a0 cellGameDataCheckCreate(2): Check dirName 2020-02-21 14:49:45 +03:00
Eladash 0c757222cb Minor improvements to sys_ss_random_number_generator
* Replace CELL_EABORT with exception.
* Improve error codes a bit.
* pkg_id == 1 should not return an error if root permission is present.
* Avoid passing vm pointers to native API, use temp buffer instead.
2020-02-21 14:49:45 +03:00
Megamouse 0ed87be47a Qt: add apply button to settings dialog 2020-02-21 10:08:22 +01:00
Silent e005581dda Gracefully fall back to a null renderer if XAudio2 fails to Init
This can happen as a non-error condition if user has no output
audio devices enabled.
2020-02-20 23:33:09 +03:00
Silent 312fc94daa Replace XAudio2 implementation with an unified Xaudio2Redist
This removes dual implementation for 2.7 and 2.8/2.9 interfaces
and also removes reliance on DirectX End User Runtimes for Windows 7.
2020-02-20 23:33:09 +03:00
Megamouse 0dd417e5f2 Add more game window title options 2020-02-20 20:07:25 +01:00
Eladash dd85e733d3 Fixup for #7304 2020-02-20 20:31:56 +03:00
Nekotekina 9e9ddf42c9 Change stdafx.h to trigger pch regeneration 2020-02-20 17:42:28 +03:00
Nekotekina 4d1f818162 umax: restore "natural" operation order 2020-02-20 17:13:41 +03:00
Nekotekina 3e0e1f668c Another attempt to fix OSX 2020-02-20 16:54:56 +03:00
scribam 4662ee0255 cmake: Update glslang build options 2020-02-20 16:23:25 +03:00
Nekotekina 2f255a528e Another attempt on umax 2020-02-20 15:18:31 +03:00
Nekotekina 987223da3f Minor fixup for /dev_flash creation 2020-02-20 14:38:09 +03:00
Nekotekina 78cc36cdd8 Allow empty /dev_flash cfg (fixup) 2020-02-20 14:07:26 +03:00
Nekotekina 580b5cda0e Revert "Maintenance: disable cotire on travis (Linux)"
This reverts commit 48c47eede4.
2020-02-20 13:45:44 +03:00
Nekotekina 81f974125c Travis: allow failure for osx 2020-02-20 13:13:48 +03:00
Nekotekina 48c47eede4 Maintenance: disable cotire on travis (Linux) 2020-02-20 13:02:57 +03:00
Nekotekina da036de3e4 Restore some /dev_flash logic 2020-02-20 12:43:53 +03:00
Nekotekina 92e3eaf3ff Fix signed-unsigned comparisons and mark warning as error (part 2). 2020-02-19 22:54:58 +03:00
Nekotekina 771eff273b First part of fixing sign-compare warning (inside be_t). 2020-02-19 22:54:58 +03:00
Nekotekina 0cf35e3b22 Implement umax global variable (max unsigned value)
Implements operators == and != comparisons.
2020-02-19 22:54:58 +03:00
Nekotekina 70bcb1cd52 Add "-Wno-macro-redefined" for clang spam 2020-02-19 21:17:23 +03:00
Nekotekina 762c8d5430 Remove -Wno-sign-compare 2020-02-19 21:17:23 +03:00
Zion Nimchuk aa9055f4c3 Switch the AppImage building over to gcc from clang
Turns out the current version of clang doesn't support the [[likely]] and [[unlikely]] attributes, so to ensure good performance, we'll be switching to gcc, at least for now.
2020-02-19 21:16:32 +03:00
Zion Nimchuk 9d1833c5a8 Bump FAudio depedency, set FAudio to build statically, enable FAudio in the build script 2020-02-19 21:16:32 +03:00
AniLeo 583220b95a .gitignore: maintenance, add missing files 2020-02-19 21:15:52 +03:00
AniLeo 85bde0f43f themes/YoRHa: Workaround broken Trophy Manager bg 2020-02-19 21:15:52 +03:00
AniLeo b96f064868 OpenAL: Update to 1.20.1 2020-02-19 21:15:12 +03:00
Eladash 6de91a1691 HLE cellGcmSys: Make IOTable accurate
Affects cellGcmAddressToOffset when using addresses above 0xC0000000
2020-02-19 18:11:30 +00:00
Eladash 1aa11440e0 HLE cellGcmSys: Make cellGcmUnmapEaIoAddress accurate 2020-02-19 18:11:30 +00:00
Eladash df8d0cde4a RSX/SPU: Accurate reservation access 2020-02-19 18:11:30 +00:00
Zion Nimchuk 57a9844279 Re-eanble gcc matrix in Travis CI, thanks to Neko for the hint 2020-02-19 10:08:58 +03:00
Eladash f02b4801b2 Fix max SPURS threads regression 2020-02-18 19:20:40 +00:00
Eladash 727d783959 RawSPU: protect NPC from writes/reads in running state 2020-02-18 18:09:10 +00:00
Eladash fad8b38b28 sys_spu: protect sys_spu_image members in kernel mode
Save relevant info in idm, set sys_spu_image segs and nsegs members to 0.
2020-02-18 18:09:10 +00:00
Nekotekina 8a176de6a1 Restore -Wenum-compare and fix some [=] warnings 2020-02-18 17:37:30 +03:00
Nekotekina 0ee2f761ae Fix warning in lf_fifo<>::push_begin() 2020-02-18 14:59:11 +03:00
Nekotekina c48ceafc15 sys_sync.h: fix warning (signed prio) 2020-02-18 14:53:23 +03:00
Nekotekina ee6494c14b Use strcpy_trync in cellAvConfExt.cpp (silence warnings) 2020-02-18 14:53:23 +03:00
Nekotekina a1456da24e Silence C++17 std::iterator deprecation warning 2020-02-18 14:53:23 +03:00
Nekotekina f08c778d2c Use more starts_with/ends_with.
Remove ends_with global func.
2020-02-18 14:53:23 +03:00
Megamouse 90f4023cb8 appv 2020-02-18 09:14:14 +00:00
Silent ea9abe7701 Qt: Update Game List Icon on changing Game List Mode 2020-02-18 00:25:21 +01:00
Nekotekina 5c42d29c98 Try to fix MSVC warning (std::iterator deprecation) 2020-02-17 22:01:11 +03:00
Nekotekina 950940febe cheat_manager: minor fix for T to be_t transition 2020-02-17 22:00:32 +03:00
Nekotekina 6e7fbc5c5c endian.hpp: fix zero array warning 2020-02-17 22:00:00 +03:00
Nekotekina 6a1a0bf48d Use std::endian for endianness test
Remove legacy IS_LE_MACHINE IS_BE_MACHINE macro.
2020-02-17 21:33:24 +03:00
Nekotekina 244e74ebe2 Try to ignore some annoying warning (seems CIB) 2020-02-17 20:56:03 +03:00
Silent aa14432846 Disable vertex cache checkbox with MTRSX 2020-02-17 20:34:07 +03:00
Ani afb594c233 gitmodules: Fix LLVM branch
gitmodules contained some old unused branch
2020-02-17 20:29:44 +03:00
Megamouse 7a7ac625cd move enum formatters from system to config files 2020-02-17 15:08:17 +03:00
Megamouse fe75311be2 move config structs to own files and clean up some headers 2020-02-17 15:08:17 +03:00
Eladash 812d03894b PPU exec/ovlm ldr: restrict allocations 2020-02-16 22:48:23 +02:00
kd-11 5e6b1003ec vk: Only declare explicit subpass dependencies for RADV 2020-02-16 18:00:06 +03:00
clienthax a08ed0d22e Fix #7445 2020-02-16 17:09:32 +03:00
Megamouse b5ed73ebe0 Qt: add reset button to game window title and center the label 2020-02-16 13:56:49 +01:00
Eladash c1bdaccd8c sceNpTrophyRegisterContext: Fix off by one progress callbacks count 2020-02-15 23:32:29 +01:00
Eladash 4421831c8b sceNpTrophyRegisterContext: Fix values passed to first callback 2020-02-15 23:32:29 +01:00
Eladash d03804b523 Fix sceNpTrophyGetTrophyInfo
* Only writeback data on success.
* Fix a typo on error code of invalid trophy ID.
2020-02-15 23:32:29 +01:00
Nekotekina 634c4355fe Fix startup failure on invalid games.yml
Add some exception checking/ignoring.
2020-02-15 22:34:10 +03:00
Megamouse ee54ba970a GUI: add custom title format to settings dialog 2020-02-15 20:33:02 +01:00
kd-11 23f1515448 vk: Explicitly declare null subpass dependencies
- We do not want any actual dependencies, but it turns out removing them
  entirely makes the driver add even worse dependencies.
2020-02-15 21:45:25 +03:00
Nekotekina 4018b833ad game_list: fix duplicate removal from games.yml
Also add some warnings.
2020-02-15 14:08:08 +03:00
Eladash ddf87864de atomic_t: Fix regression from #7489 2020-02-15 14:07:52 +03:00
Eladash 299af768e8 HLE cellGcmSys: Make cellGcmAddressToOffset accurate 2020-02-15 14:07:52 +03:00
Megamouse e645627b78 Qt: Allow for duplications in game list
This fixes app versions when multiple game data directories were found.
We only removed duplications because we didn't wanna see multiple disc games from different locations
2020-02-15 11:36:01 +01:00
Megamouse 1cb1d14d0c Qt: only add version update hint to bootable applications 2020-02-15 11:36:01 +01:00
Megamouse 1c2df15755 Qt: simplify category localization in gamelist refresh 2020-02-15 11:36:01 +01:00
Megamouse 687bb1697b Qt: fix gamelist version check regression after localization changes 2020-02-15 11:36:01 +01:00
Eladash 04e0bf2eff Whitespace fix after #7087
Was this close to enter programmers' hell.
2020-02-15 11:37:13 +03:00
Eladash eb8710d3c1 atomic.hpp: C-style casts cleanup 2020-02-15 11:37:13 +03:00
Eladash e98fcfdf77 rsx debugger: Fix a crash on opening before rsx was intialized 2020-02-15 10:41:42 +03:00
Eladash cdda19c79f Fix recursive locking in sceNpTrophyUnlockTrophy 2020-02-15 10:41:15 +03:00
Eladash fa9330d0e0 Log returned reqspace in sceNpTrophyGetRequiredDiskSpace 2020-02-15 10:41:15 +03:00
Eladash 1d4595a349 Idm: Minor assert fix 2020-02-15 10:41:15 +03:00
Eladash 9344b21484 rsx: Unify FIFO recovery methods
TODO: Maybe consider fifo stack content when recovering.
2020-02-14 17:11:26 +03:00
Eladash 07f300a14e rsx: ZCULL typo fix 2020-02-14 17:11:26 +03:00
Eladash ddeb39d8de HLE cellGcmSys: Fix unmapping 2020-02-14 17:11:26 +03:00
Nekotekina 0d7aa5e310 GUI: implement custom title format
New option "Window Title Format" in Misc.
Backward compatible with FPS disabler.
Make rpcs3:::get_branch() return string_view.
2020-02-13 21:24:52 +03:00
Eladash 606693a9f7 Avoid closing the emulator after access violation 2020-02-13 14:14:28 +03:00
Eladash 78c49e7331 cellSearch: another memory access fix 2020-02-12 20:02:18 +03:00
Eladash 9760053c8c cellSearch: Fix id memory access (#7476) 2020-02-12 18:17:45 +03:00
Nekotekina e8988faed5 geometry.h: remove MSVC workaround 2020-02-12 12:50:42 +03:00
Nekotekina 7137142351 geometry.h: more cleanup
Remove wrong constructors.
2020-02-12 12:50:42 +03:00
Zion Nimchuk bacd234258 Add a check for GLIBCXX_3.4.26 support in the AppImage checker binary 2020-02-12 12:49:46 +03:00
Silent 3006b003c4 Implement links as a cellSearch specific concept
Linking in VFS is done only from cellSearchPrepareFile and works
by mounting virtual files to host FS files
2020-02-12 12:49:02 +03:00
Silent e30637351e Move SearchState to a fxo object so it resets with emulation 2020-02-12 12:49:02 +03:00
Silent d2b83c69bb cellSearch updates from Brolijah
Co-authored-by: Brolijah <brolijahrh@gmail.com>
2020-02-12 12:49:02 +03:00
Nekotekina bcbe324534 geometry.h: make conversion operators explicit
It requires static_cast<> to call them.
2020-02-11 13:21:45 +03:00
Eladash dcb30df7c8 rsx capture: Fix capture recovery after a crash 2020-02-10 21:39:39 +00:00
Eladash bdab26ec09 rsx: rewrite io mappings
Along with some with fixes to cellGcmSys HLE.
2020-02-10 21:39:39 +00:00
kd-11 f47333997f rsx: Validate memory blocks before checking for overlap 2020-02-10 21:48:35 +03:00
kd-11 3787108ee7 rsx: Typo fix in audit condition 2020-02-10 21:48:35 +03:00
Megamouse 30d176ac5e Qt/linux: set DISPLAY variable if undefined 2020-02-10 21:48:13 +03:00
RipleyTom 98f91457bf Small sys_usbd changes 2020-02-10 21:47:48 +03:00
Megamouse 6847e52364 Fix visual studio filters after someone tinkered with the files 2020-02-10 21:47:13 +03:00
Zion Nimchuk 896d16ec7b Bump minimum Qt5 version to 5.14.0 in CMake 2020-02-10 21:46:35 +03:00
Megamouse 6862790cf7 Qt: icon overhaul 2020-02-10 17:38:19 +01:00
Eladash 639245c071 Make handle_access_violation noexcept 2020-02-10 17:27:34 +03:00
Nekotekina 034267adb2 Compilation fix 2020-02-10 16:57:56 +03:00
Nekotekina 6e47a6fb76 Update LLVM for C++2a workaround 2020-02-10 14:47:12 +03:00
Nekotekina 9569ae24e0 Bump minimal compiler versions: gcc-9 and clang-10. 2020-02-10 14:47:12 +03:00
Nekotekina 491526b421 Add option USE_COTIRE=ON (by default)
Precompiled headers cause rebuild problems with ninja, for example.
2020-02-10 14:47:12 +03:00
Nekotekina 5a41d75eb8 Silence unused parameter warning 2020-02-10 14:47:12 +03:00
Nekotekina 4bc431ec31 Silence deprecation warning (implicit capture of this on [=]) 2020-02-10 14:47:12 +03:00
Nekotekina 1bc9fd2863 Set cmake min version and CXX_STANDARD to 20 2020-02-10 14:08:51 +03:00
Megamouse 5d82b0f4c4 Qt: set min version to 5.14 2020-02-10 14:05:36 +03:00
Zion Nimchuk d3abff5486 Disable FAudio due to upstream packaging issues 2020-02-10 13:31:29 +03:00
Zion Nimchuk 77aa1fbeea Bump glslang to fix issues with LLVM 10 2020-02-10 13:31:29 +03:00
Zion Nimchuk af9bc631cc Bump Docker version, update clang10+gcc9, CMake 3.16, adds SDL2, LLD
The vulkan library and SDL2 libraries are now self-built, due to distro packages being too low version
2020-02-10 13:31:29 +03:00
RipleyTom 762718002e make decrypt default to All Binaries 2020-02-10 09:45:06 +01:00
Maxim Kulyk 16bbd93885 [props] Move stdcpplatest and FH4 to common_default.props
This way stdcpplatest  and FH4 disabling propagates to all projects except llvm and glslang.
2020-02-09 17:32:02 +03:00
Eladash 80eff58950 cellAudio: Implement cellAudioSet/RemoveNotifyEventQueueEx 2020-02-09 12:31:55 +00:00
Nekotekina 7ea4eb0095 Atomic fix
Fix possible pointer arithmetic ops.
Fix fat atomics (currently unused).
2020-02-09 14:09:29 +03:00
kd-11 efc8c3f4a9 vk: Fixup for VK_ERROR_SUBOPTIMAL_KHR
- break from a switch does not break out of the external scope!
2020-02-09 13:45:30 +03:00
kd-11 792c481f6d rsx/overlays: Fix clipped rendering of UI elements
- Take viewport offset into account when applying window transforms.
  This is necessary because gl_FragCoord is based on the framebuffer and not the viewport.
2020-02-09 12:55:56 +03:00
13xforever 7973b01b1c update issue templates 2020-02-09 08:29:33 +00:00
Eladash 11675d7645 Compilation fix for VSH pr 2020-02-09 06:48:16 +00:00
Eladash 1915fe75a4 VSH: Stubs 2020-02-08 23:07:03 +03:00
Eladash 9d1bb60ad7 cellGcm HLE: fix cellGcmMapMainMemory
Fix arguments order, softcode RsxReports::report offset.
2020-02-08 22:18:56 +03:00
Eladash b7043ce000 Make rsx::get_address report caller location 2020-02-08 22:18:56 +03:00
kd-11 c64935f9dd rsx: Clean up graphics state notifications and add notification for change in point size
- Adds a backend notification when point size changes.
- Refactors all those separate notifiers into one reusable template.
2020-02-08 18:13:05 +03:00
Eladash 629eddfb9f sceNpTrophy: Implement SCE_NP_TROPHY_ERROR_CONTEXT_NOT_REGISTERED 2020-02-08 11:11:59 +00:00
Eladash 1f94c8f272 sceNpTrophyGetGameProgress Fix 2020-02-08 11:11:59 +00:00
Megamouse 0c8611bd49 Qt: fix game category localization 2020-02-08 11:04:13 +01:00
Megamouse 5dcb91b671 Restart games with the same config instead of global 2020-02-08 11:04:13 +01:00
Megamouse 7abda27b46 Fix Boot inconsistencies for Reloads 2020-02-08 11:04:13 +01:00
Megamouse 901fc87bca Only start the playtime clock if it makes sense 2020-02-08 07:13:29 +01:00
kd-11 54da9ac7e5 overlays: Fixup
- Avoid calling join on self thread.
- Avoid use-after-free.
2020-02-07 19:28:41 +03:00
kd-11 e45360de2b overlays: Fix use after free
- Overlay can be closed when secondary thread is asleep!
  Wait for it to wake before proceeding with deletion.
2020-02-07 16:15:02 +03:00
kd-11 d59c449ff6 vk: Remove an overzealous assert 2020-02-07 16:15:02 +03:00
MSuih 17df6c8878 Enable C++20 for MSVC in CMakeLists.txt 2020-02-06 22:15:58 +00:00
eladash f901846acb RawSPU: execute MFC proxy cmd after reading CMDStatus
Implement MFC proxy argument sequence checking.
2020-02-06 20:43:38 +00:00
Megamouse edcd2fc14a Qt: fix game grid regression 2020-02-06 19:58:19 +01:00
Megamouse 382bdcdcb7 Qt: set Tooltips.h to UTF-8 in order to fix translation with special characters 2020-02-06 17:41:50 +01:00
Megamouse 1bbc60c3e7 Qt: do not use localized filenames for default current config and default stylesheet 2020-02-06 17:41:50 +01:00
Megamouse c13d345604 Qt: add language menu 2020-02-06 17:41:50 +01:00
Megamouse efe907ffae Qt: use config to load translation file on startup 2020-02-06 17:41:50 +01:00
kd-11 0bba04ef8d vk: Fix a bug in RCB/RDB when MSAA is set to disabled.
- Initially MSAA option was hardcoded to be always enabled, this bug is a remnant of that time.
2020-02-06 17:54:05 +03:00
kd-11 43dae6c14d gl: Implement RCB/RDB 2020-02-06 17:54:05 +03:00
kd-11 2b5c24b304 gl: Fix memory barrier implementation and stub for RCB/RDB
- It's a miracle it even compiled
2020-02-06 17:54:05 +03:00
kd-11 50b1e26b17 gl: Fix a long-standing regression with typeless transfer caused by a typo.
- The parameters for the final upload should be 'unpack_info' not 'pack_info'!
2020-02-06 12:44:46 +03:00
kd-11 18e0559438 gl: Fix per-level sub-image sizes to comply with OpenGL guidelines for compressed textures 2020-02-06 12:44:46 +03:00
Eladash 37513b1898 SPU reservations: Do not access violate under vm::writer_lock
TODO: Throw exception when encountering page faults notification enabled memory
2020-02-06 00:27:17 +00:00
Silent fbbad7c851 Include trailing separators in section split
This fixes the case on Windows where one of the paths ends up consisting
only of a drive letter and no trailing slash - in which case Windows
treats it as "current directory on drive X" and not "root of drive X"
and GetFileAttributes throws an invalid param error
2020-02-05 23:21:32 +00:00
Eladash f8b3c48af7 sys_spu: Implement proper SPU group flags (#7320)
* sys_spu: Implement proper SPU group flags
2020-02-05 20:46:05 +00:00
kd-11 3cc42c1bf8 gl: Fix broken image transfer operations 2020-02-05 18:18:09 +03:00
kd-11 b6422c9a33 rsx: Fixup
- Destination Y coordinate must be 'rebased' onto the current slice by subtracting its offset.
  Only the local path was affected this time
2020-02-05 18:18:09 +03:00
Eladash 049e392a97 Make preferred spu threads dynamically adjustable 2020-02-05 10:06:07 +00:00
Eladash 9a64d08c9f Make sleep timers accuracy dynamically adjustable 2020-02-05 10:06:07 +00:00
Nekotekina c0f80cfe7a Use attributes for LIKELY/UNLIKELY
Remove LIKELY/UNLIKELY macro.
2020-02-05 10:42:34 +03:00
Eladash 49e11b7cfd cellVdecQueryAttrEx: Add some error checks for MPEG2 2020-02-05 05:01:07 +00:00
Eladash 6a32ceaab5 cellVdecQueryAttrEx: Add workaround for codec specific info 2020-02-05 05:01:07 +00:00
Eladash acc7320cae Fix cellVdecGetPicItem
Fix potential overflow, race condition and correctness fixes for picInfo_addr
2020-02-05 05:01:07 +00:00
Nekotekina 1a78e0e80c Make RPCS3 compile in C++2a mode 2020-02-04 23:43:55 +03:00
Eladash e9e8f0c5b7 cellGame: report not found sfo params 2020-02-04 18:29:52 +03:00
Eladash cb52ee0a4d cellGame: report fs::remove_all failure 2020-02-04 18:29:52 +03:00
Eladash 4488312e81 Avoid out of memory with cellGameGetParamString 2020-02-04 18:29:52 +03:00
kd-11 9d9b5c4d66 rsx: Rewrite coverage test to take sum of areas into account.
- TODO: A proper sweep algorithm to calculate sum of overlapping rectangles
2020-02-04 16:20:52 +03:00
kd-11 b9ec012922 rsx: Allow for proper data checks when WCB/WDB is enabled 2020-02-04 16:20:52 +03:00
Megamouse d47a8b49a4 Qt: use current locale for last played in gamelist
This also sets the basic groundwork for Qt translations
2020-02-04 09:18:05 +01:00
Megamouse 1759d6d90a Qt: fix gamelist sorting for playtimes 2020-02-03 21:22:11 +01:00
Nekotekina c4a01875d0 Space fix commit 2020-02-03 11:16:26 +03:00
Nekotekina f9a8efe406 SPU LLVM: gisable NewGVN pass
It goes into an endless loop with memory leak for some reason.
2020-02-03 11:16:03 +03:00
Silent 7f4e546f19 Protect m_storage.find(key) to fix a race 2020-02-02 22:28:14 +03:00
Nekotekina 0a2874405d logs: allow disabling RPCS3.log.gz
Disabled by creating a directory with the same name.
2020-02-02 14:32:29 +03:00
Nekotekina 87a5dd66ab Move logs::channel registration out of the constructor
Allow constinit initialization of logs::channel.
2020-02-02 14:12:54 +03:00
Eladash e57c01907e cellVdec: Improve cellVdecQuery and cellVdecOpen 2020-02-02 09:01:32 +03:00
Nekotekina 32df809626 Update llvm (fixup) 2020-02-01 19:05:36 +03:00
kd-11 7d2ed9200d rsx: Remove sections that are wholly inherited by new blocks
- Allows sections reclaimed by the surface store due to overlap/inheritance to be identified and removed.
- Additionally, potentially lowers the number of flushes required per block with multiple overlaps improving efficiency and theoretically performance.
2020-02-01 15:14:29 +03:00
Nekotekina f6e90b4c72 Fix FAudio logging 2020-02-01 13:34:36 +03:00
InvoxiPlayGames c1180d76dd sys_usbd: Fix bug preventing multiple USB devices 2020-02-01 12:34:42 +03:00
Nekotekina 6dfd97f0b6 Modernize SPU logging (spu_log variable) and remove log legacy
Remove legacy macro (LOG_ERROR, etc)
2020-02-01 11:52:52 +03:00
Nekotekina 327bb2d8f0 Modernize PPU logging (ppu_log variable) 2020-02-01 11:52:24 +03:00
Nekotekina 21f7b0ff0f Remove HLE log channel 2020-02-01 11:52:24 +03:00
Nekotekina 15391f45d0 Modernize RSX logging (rsx_log variable) 2020-02-01 11:52:22 +03:00
Nekotekina 3c0bd821c8 Give log channels fancier names
Improve LOG_CHANNEL macro to accept custom name.
2020-02-01 10:43:43 +03:00
Nekotekina ec80932c21 logs: use relaxed atomics
May help with optimizations.
2020-02-01 10:30:03 +03:00
Nekotekina 3eca2d5d6c Remove legacy LOADER log channel 2020-02-01 07:49:38 +03:00
Nekotekina d9a0619ddd Remove legacy GENERAL log channel
Add some more log channels instead.
2020-02-01 07:49:38 +03:00
Nekotekina efafda2650 Add config to silence all logs 2020-02-01 07:49:38 +03:00
Eladash 943368912b Hotfix after #7351 2020-02-01 05:50:58 +03:00
Nekotekina 1d0f359406 logs: add more log channels instead of GENERAL 2020-01-31 16:44:48 +03:00
Nekotekina d5f019c3d3 Implement logs::silence
Disables all log channels.
Also disables unsupported "default" log level for log channels.
2020-01-31 16:44:48 +03:00
Nekotekina 67075dfc6c logs: cleanup for audio backends
In process of removing GENERAL log channel.
2020-01-31 16:44:48 +03:00
Nekotekina a867522b16 logs: implement logs::get_channels() 2020-01-31 16:44:48 +03:00
Nekotekina 26cccead6e logs: remove legacy MEMORY channel
Add channels vm_log, sig_log.
2020-01-31 16:44:48 +03:00
Asinine e6f7467f67 Update missing rap file error 2020-01-31 14:13:55 +01:00
kd-11 36d5db7f30 rsx: Plug texture data leak in the 'exact match' path.
- Followup to previous texture data leak fix for the replaced section path.
2020-01-31 14:56:53 +03:00
Nekotekina e7b24461ec Implement logs::get_level 2020-01-31 12:09:52 +03:00
Nekotekina 007a7a5859 Fixup for LOG system.
Register all channels at program initialization and allow duplicates.
2020-01-31 12:09:52 +03:00
Nekotekina 59a0f810b9 Implement fat atomics
Atomics with embedded mutex bit.
2020-01-31 12:09:52 +03:00
Silent 9f678cc47a Fix code relying on initialization order
Allows Debug - LLVM to boot
2020-01-31 11:23:55 +03:00
Silent aeebcfe141 Fix Debug - LLVM in VS project files 2020-01-31 11:23:55 +03:00
Eladash 48a847d1b6 Qt: Bugfixes regarding usage of ShowConfirmationBox 2020-01-30 21:49:08 +01:00
Eladash 232c6c3aaf Qt: Display "Reboot With Custom/Global config" on running game 2020-01-30 21:49:08 +01:00
kd-11 c9e35926f5 rsx: Preserve pixel data when splitting sections
- Ironically rhis data leak is caused by trying to fix another type of data leak
2020-01-30 21:07:36 +03:00
Megamouse 8ef69429d8 Add early out to pkg_install 2020-01-30 18:21:18 +01:00
Megamouse 336cd6e33a Qt: Prevent Qt from blocking the explorer during installations 2020-01-30 18:21:18 +01:00
Silent 360e484b08 Fix ellipsis
… is an UTF-8 character and those don't really belong in messages like this anyway
2020-01-30 16:06:00 +03:00
Eladash 92466165f6 Increase Maximum Vblank Rate and Clocks Scale
Allow x30 times the speed of vblank rate + clocks scale of original PS3.
In theory a 60 fps limit game which scales frame limit perfectly with vblank rate can be played at up to 1800 fps with this change.

And:
* Fixed lv2 sleep with Clocks Scaling
* Make these settings dynamicaly adjustable.
* Avoid code duplication
2020-01-29 21:42:41 +01:00
kd-11 1206a5d4b7 rsx: Tweak blit engine heurestics a bit
- Reject writes to RTT if the source data is of unknown origin.
  non-RTT data and only 1 line in length is suspicious and often GPU data like programs or other rendering inputs.
2020-01-29 12:54:06 +03:00
TotalCaesar659 c1d7b46235 Qt: change labels in package installer (#7325) 2020-01-29 00:39:05 +01:00
RipleyTom 795bc5d52b Add mutex guard for s_unfire 2020-01-28 19:16:16 +03:00
Malcolm Jestadt ad8988afd3 Embedded SPU elf patching
- PS3 games include both PPU and SPU code in their PPU executables, so to make patching games that make use of the same SPU libraries easier, we add a system to find and patch them.
- Patches for this system still use SPU LS (Local Storage) addresses despite the fact that we aren't loading anything into SPU LS at this time. The patches are checked against each segment and patched in place.
2020-01-28 02:13:37 +03:00
Ivan 7f07b79c04 Partial revert of #7180
PC is PS
2020-01-27 07:05:18 +03:00
RipleyTom 610a6a1404 Increases number of buffers when buffering 2020-01-27 02:13:30 +00:00
Eladash a7aef22754 ppu: Log SELF header information and CIA of caller HLE functions 2020-01-27 01:21:40 +00:00
Eladash 4e0070f16d Log sys_spu thread group and thread names
Also safely read thread name after relevant error checks passed.
2020-01-26 20:32:10 +00:00
Eladash 7ae679adbe Fix logging of ppu name in sys_ppu_thread_create/rename 2020-01-26 20:32:10 +00:00
Eladash d481c3c7fd cellGameGet/SetParamString: Implement CELL_GAME_ERROR_NOTSUPPORTED 2020-01-26 20:32:10 +00:00
Eladash a9162a3f57 SPU LLVM: Improve approximate FCMGT 2020-01-26 18:37:07 +00:00
Megamouse b341113ad8 Qt: Change some labels 2020-01-26 18:46:04 +01:00
Nick Renieris 1e69de1205 overlays/perf: Graph label tune-up
Place graph text on top, split in 2 lines, center it horizontally.
Also if it's wider than the graph, match up graph's width to it.
2020-01-26 17:55:11 +01:00
kd-11 79216917b3 rsx: Workaround for broken rtt resampling
- Avoids WCB requirement for now to keep res scaling working correctly.
- TODO: Fix this properly
2020-01-26 13:58:48 +03:00
kd-11 698702cd4a vk: Fix DMA data leak
- There still does not exist a ranged flush implementation which is required.
- TODO: Implement this properly
2020-01-26 13:58:48 +03:00
kd-11 1166ae19bb vk: Use appropriate layouts depending on use case when creating new textures to avoid needless barriers 2020-01-26 13:58:48 +03:00
kd-11 44f2cacf7b rsx: Blit engine tuning
- Attempt to identify blit operations that will be flushed immediately
after and just do them on CPU instead if the transformation is trivial.
- If only a single blit section is contributing to an atlas merge op, the
threshold should be 100%. The only acceptable result here is a
truncation.
2020-01-26 13:58:48 +03:00
kd-11 7a275eaa3a rsx: Fix incomplete blit operations getting used as texture inputs
- Raise passing 'score' from 50% to 90% to filter out very incomplete
merge operations.
- Catch unfit sections passing the match test; possible for blit_dst
data but will likely be always harmless. Disabled in release builds by default.
2020-01-26 13:58:48 +03:00
Silent 331c1a394a Qt: Present game removal failure to the user
All the required information was already there,
but UI always reported success
2020-01-25 19:28:52 +01:00
Eladash e4ba096190 VSH: sys_mmapper
* Implement syscalls sys_mmapper_allocate_shared_memory_ext, sys_mmapper_allocate_shared_memory_from_container_ext.
* Implement multi-process shared memory allocations.
2020-01-24 20:08:30 +00:00
Eladash 46df58b662 sys_usbd: Add error_code 2020-01-24 19:25:52 +00:00
Eladash 95ed2ef62e cellGcm HLE: Add error_code 2020-01-24 19:25:52 +00:00
Megamouse 3f076d63e3 HLE: add error checks to cellAudioInGetDeviceInfo 2020-01-23 10:50:55 +01:00
Megamouse 3e8a5c6395 HLE: add some more constants 2020-01-23 10:50:55 +01:00
Megamouse 18f167ddd0 HLE: Fix error checks in cellAudioInRegisterDevice 2020-01-23 10:50:55 +01:00
Maksim Derbasov 1abdee242a small improvement (#7288)
* small improvement

* comments addressed

Co-authored-by: kd-11 <15904127+kd-11@users.noreply.github.com>
2020-01-22 12:28:48 +00:00
kd-11 adcc3e9c4b rsx: Optionally sync on texture read semaphore
- Some games use texture semaphore for zcull sync which is rather bizzare.
  However, it works on realhw as the depth test happens before fragment shader completion
- Due to the high performance penalty incurred by this act, this
behavior is only enabled by the "strict rendering mode" option.
2020-01-21 22:21:51 +03:00
Eladash 949cfa7fdb Fix cellVdecSetFrameRate error check 2020-01-21 16:45:41 +03:00
Eladash fe381b8581 SPU: Add SPU LS to debugger 2020-01-21 16:45:41 +03:00
Eladash 160ddcf86b SPU: Minor FREST bugfix 2020-01-21 16:45:41 +03:00
Eladash f05a3da964 Fix lv2_file::op_write regression 2020-01-21 16:45:41 +03:00
Nekotekina ddda09607d SPU: fixup for STOP 0w0 2020-01-21 16:32:00 +03:00
Eladash 9993df9b8b RawSPU: fix race between spu start and stop
This race could lead to spu status bits indicate RUNNING status, but cpu state being stopped.
Fix it by making sure cpu state is set before spu status.
2020-01-21 14:08:39 +03:00
Nekotekina 98a8eeaac2 SPU: properly support STOP 0x0 instruction 2020-01-20 23:40:10 +03:00
Nekotekina 0f87c6c7c3 Make system config thread-safe (almost) 2020-01-20 21:51:28 +03:00
Nekotekina 0147bc2c72 Fixup shared_cptr, atomic_cptr 2020-01-20 21:51:28 +03:00
Nekotekina 1e7a02badb Implement shared_cptr and atomic_cptr
Limited shared_ptr with atomic support.
Atomic version is only partially implemented.
2020-01-20 16:53:42 +03:00
Nekotekina 3617f12a1e sys_fs: avoid possible out of memory on file reads/writes
Use fixed-sized intermediate buffer.
2020-01-20 16:00:20 +03:00
Nekotekina 63f67c88cc sys_fs: better stub sys_fs_fcntl(0xc0000006)
This syscall does something to classify filesystems by mountpoint.
2020-01-20 16:00:20 +03:00
Nekotekina 1b1b804d7e sys_fs: add /dev_flash mountpoint 2020-01-20 16:00:20 +03:00
Nekotekina 55cb96ab3b sys_fs: fix CELL_EIO condition in cellFsReadWithOffset 2020-01-20 16:00:20 +03:00
Megamouse 5ef3465f65 cellVdec: (experimental) allow AV_PIX_FMT_YUVJ420P 2020-01-20 00:33:25 +01:00
Megamouse 9a27cc9442 cellVdec: improve error checks 2020-01-20 00:33:25 +01:00
Megamouse 858ce014fd VS: fix filter facepalm 2020-01-19 16:38:17 +01:00
Megamouse 4dbad6cce6 fix some random warnings 2020-01-19 16:38:17 +01:00
Megamouse 485b22d664 Qt: fix deprecation warnings 2020-01-19 16:38:17 +01:00
Megamouse 30d5a849e3 Qt: enlarge some tooltip hover areas in settings 2020-01-19 12:40:43 +01:00
MSuih 9ef96e8274 Add pagesteps for some controls
With the snap changes the default pagestep of 1 is ignored because of rounding.
2020-01-19 09:09:36 +01:00
MSuih cbaa8f3329 Add snapping and limit range for wakeup delay 2020-01-19 09:09:36 +01:00
MSuih 807d6cfea4 Add slider snapping 2020-01-19 09:09:36 +01:00
kd-11 22ca2827de rsx: Improve window border detection and clearing
- Improves logic to detect if the frame requires letterboxing and
properly clears the background appropriately.
2020-01-18 19:52:52 +03:00
kd-11 5e0ca4c0c4 rsx: Fixup for missing visuals when framebuffer is larger than requested
display dimensions.
2020-01-18 19:52:52 +03:00
kd-11 48407752a6 formatting: Unify indentation type in the newly added files to tabs 2020-01-18 19:52:52 +03:00
kd-11 bad4d1ff05 rsx: Improve present image scanning
- Adds support for partial (letterboxed) source images by taking insets
into account.
- Bugfix for potential access violation when capturing screenshot on
vulkan
2020-01-18 19:52:52 +03:00
kd-11 7453e46a7c rsx: Refactor out complex present code into separate files
- Also restructures present code to have image lookup in a separate
re-usable function.
2020-01-18 19:52:52 +03:00
Eladash b07b5c9005 Fix sys_spu_thread_initialize for attr->name_len is 0 and attr->name is not null
If name_len is 0 name is empty, in any other case name is not empty (attr->name == nullptr isn't allowed in this case).
Check name_len and option for invalid values as fw.
2020-01-18 18:46:13 +03:00
Eladash 9d15083c61 Fix sys_ppu_thread_create/rename thread name range 2020-01-18 18:46:13 +03:00
Eladash 14b99d9e8b Write nread/nwrite in cellFsWrite/Read regardless of error checks 2020-01-18 15:56:05 +03:00
kd-11 b36b9e4822 vk: Fixup for total number of combined samplers using the dynamic binding structure 2020-01-18 11:17:19 +03:00
kd-11 0a2b6a290d vk: Fixup
- Scaling is not needed for a direct typeless transfer!
2020-01-17 14:31:14 +03:00
Emmanuel Gil Peyrot ca5bc512ae Optimise the SVG logo with svgcleaner
It still contained Inkscape leftovers, which are of no use for anything.
There are no functional changes.

See https://github.com/razrfalcon/svgcleaner
2020-01-17 08:31:00 +01:00
Megamouse 449cbb7281 Qt: use persistent_settings for playtimes 2020-01-17 07:43:10 +01:00
Nekotekina e2512e78b6 sys_fs: always close locked file in sys_fs_close
Syscall returns EBUSY but succeeds nevertheless.
2020-01-17 00:24:07 +03:00
Nekotekina a005090d3d sys_fs: use constant in sys_fs_disk_free 2020-01-17 00:24:07 +03:00
Nekotekina 7fcc49004d lf_fifo: fix UB and fix size()
Simplify internal counter to atomic<u64>.
Make size() return correct difference between push and pop pointers.
2020-01-17 00:24:07 +03:00
MSuih 833fbe015e Use floating point pixel ratio 2020-01-16 23:54:47 +03:00
Eladash c9b0f0e734 SPU: Fix FREST 2020-01-16 23:42:50 +03:00
kd-11 9b34f00241 vk: Optimize image transfers
- Adds the same optimization/simplification steps to complex image
transfer routines. Whenever possible, multi-step transfers are collapsed
into a single operation.
2020-01-16 22:29:26 +03:00
kd-11 82af17beb1 gl: Optimize image operations
- Avoid double transfers where a transfer to a temp image is done
without scaling and then a secondary transfer follows. Combines the two
steps into one whenever possible which can significantly alleviate
bandwidth problems at higher resolutions. Significant speedup, upto 90%
in some cases (PDF, PDF2)
2020-01-16 22:29:26 +03:00
kd-11 47b196e9d0 rsx: Fix uninitialized variable 2020-01-16 17:57:31 +03:00
kd-11 db014d8a58 rsx: Fix section length calculations when generating new blit targets. 2020-01-16 17:57:31 +03:00
kd-11 621fab2ad9 vk: Fix D32S8 interpolation by using integer interpolation instead of floating point
- Interpolating floats is not the same as interpolating their bits!
  Use integer format to interpolate linearly for D32F formats instead of using R32F as intermediary
2020-01-16 11:12:08 +03:00
kd-11 086ecf4ba6 vk: Add some missing image memory barriers causing artifacting on AMD cards
- There needs to be a memory barrier after each step.
- TODO: Optimize scale_typeless_safe function
2020-01-16 11:12:08 +03:00
kd-11 309251ce7a rsx: Touch locked dst memory after blit transfer operations in case it is locked by WCB/WDB 2020-01-16 11:12:08 +03:00
Eladash 9084209cfc Update cellVdecSetFrameRate error checking 2020-01-15 23:29:32 +01:00
kd-11 74ad525566 vk: Fixup for cs_scatter job
- Access to the stencil output has to be atomic as each 'word' is shared among 4 adjacent texels
- TODO: Can be optimized using mirrored buffer views
2020-01-15 21:12:51 +03:00
Eladash 05e5e6058f Add description for rsx wake-up delay 2020-01-15 19:54:23 +03:00
MSuih 556ac1cf22 Add wake-up delay to settings 2020-01-15 19:54:23 +03:00
Eladash 85695c8bac rsx: FIFO wake-up pause control 2020-01-15 19:54:23 +03:00
kd-11 2984300385 vk: Fix invocation alignment to support non-power-of-2 alignment 2020-01-15 15:42:36 +03:00
kd-11 ac4cadf538 vk: Fix word index counting for shuffle tasks 2020-01-15 15:42:36 +03:00
kd-11 175f78f5b3 vk: Lower default compute heap size to 64M
- There is no need to guess and use a large memory footprint as the heap is
now dynamic.
2020-01-15 15:42:36 +03:00
kd-11 3d96fe79cc vk: Implement dynamic sized compute heap
- Implements a dynamically sized compute heap to allow growing up the
size if it is too small.
2020-01-15 15:42:36 +03:00
Eladash 1ccb3c4492 rsx: Verify local memory offset 2020-01-15 13:23:56 +03:00
Eladash 01035d35bd sys_process: Fix sys_process_get_id, add error_code (#7246) 2020-01-14 21:32:41 +03:00
kd-11 8bbda3dedb vk: Restructure command queue flushing behavior to avoid deadlock
- Queueing commands on the offloader is a good idea but unfortunately
page faults can still happen causing a cyclic dependency and eventual
deadlock. Characterized by a vk::wait_for_event timed out error
accompanied by severe hitching.

- Drain the fault-able commands before pushing a submit operation to the
queue. If a fault is in progress, bypass the queue system and submit
raw. Technically this is incorrect but there isn't much that can be
done about it right now.
2020-01-14 14:32:40 +03:00
Megamouse a24514651c Update Appveyor to Qt 5.14 2020-01-14 10:15:35 +01:00
Megamouse 542d2ef8da Qt: smoother batch package installation 2020-01-14 09:27:09 +01:00
Megamouse be2d225d96 sceNpTrophy: deny unlocking of platinum trophies 2020-01-13 22:50:05 +01:00
Eladash 765bd6b6c6 SPU: Optimize gpr reset for MSVC 2020-01-11 22:56:46 +03:00
Nekotekina aeed349a99 sys_fs: adjust permissions for /dev_bdvd
Remove write permissions returned by stat, fstat, etc.
Also make sys_fs_open return CELL_EPERM on write attempt.
2020-01-11 04:48:42 +03:00
Nekotekina 8447d75dda sys_fs: improve sys_fs_lsn_lock
It appears it does nothing only on /dev_hdd0 or /host_root (HOSTFS).
2020-01-11 03:44:52 +03:00
Nekotekina fc6356a74c sys_fs: adjust /dev_bdvd block size
From test.
2020-01-11 03:05:26 +03:00
Nekotekina 41f2ee7b6c VFS: minor change in handling /host_root path 2020-01-11 01:55:36 +03:00
Nekotekina 87cd653c6e sys_fs: improve sys_fs_disk_free
Fix error codes and arg checks.
2020-01-11 01:10:50 +03:00
Nekotekina 7e35fd54a8 sys_fs: improve sys_fs_fcntl(0xc0000002)
Always obtain free space on /dev_hdd0.
2020-01-11 01:09:30 +03:00
Nekotekina 582ee80552 sys_fs: correct block size for /dev_hdd1 2020-01-10 05:24:43 +03:00
Nekotekina 0b4b87f069 sys_fs: fix sys_fs_get_block_size
Don't check file existence on /dev_hdd0.
Relax check on some mountpoints.
Fix CELL_EISDIR error condition.
2020-01-10 05:19:18 +03:00
Nekotekina a8e1afa0af sys_net: fix sys_net_bnet_select arg check (nfds) 2020-01-10 03:21:27 +03:00
Eladash 71df5044fc sys_vm_get_statistics: Write timestamp 2020-01-09 20:43:03 +00:00
kd-11 db5d03c340 vk: Generate dynamic binding table based on the capability of the drivers
- This alleviates constraints imposed on shaders to allow running on some not-so-great platforms.
2020-01-09 15:38:23 +03:00
RipleyTom 4a5559ee65 Add buzz controllers to usb whitelist 2020-01-09 07:51:16 +00:00
Nekotekina 7523416a12 sys_fs: return CELL_ENOTSUP in sys_fs_fcntl(0xc0000006) 2020-01-09 04:15:20 +03:00
Nekotekina 9075208c80 sys_fs: fix logging in sys_fs_get_block_size 2020-01-09 04:15:20 +03:00
Nekotekina d477889763 sys_fs: fix mountpoint detection 2020-01-09 04:15:20 +03:00
kd-11 ef3b0db7d8 vk: Workaround for NVIDIA occlusion query failure
- When using partial results on NVIDIA, a non-zero result is returned even when the draw is fully occluded.
  This, I believe, violates spec which says the partial result shall be between 0 and the final result.
2020-01-08 19:02:45 +03:00
Nekotekina f5cb147f8d sys_fs: improve sys_fs_get_block_size values
Affected other syscalls:
sys_fs_fget_block_size
sys_fs_stat
sys_fs_fstat
sys_fs_fcntl (cellFsGetDirectoryEntries, cellFsGetFreeSize)

For default values:
Return sector_size = 512.
Return 4th arg = 512.
Fod /dev_bdvd:
Sector size = 2048.
Block size = 2048.
2020-01-07 23:16:17 +03:00
Nekotekina 63e669c0cf sys_fs: fix sys_fs_fget_block_size
Return flags via last argument.
2020-01-07 21:55:19 +03:00
Nekotekina 9c54305e10 sys_fs: disable sys_fs_lsn_lock/unlock
According to test, nothing seems to happen.
Disable CELL_EBUSY errors associated with Stream Support API.
2020-01-07 21:55:19 +03:00
Nekotekina f3d52de429 sys_fs: Adjust flags of /app_home mountpoint 2020-01-07 21:55:19 +03:00
kd-11 3f34a0196c overlays/osk: Add linear fade-in/out effect to OSK 2020-01-07 21:31:19 +03:00
kd-11 ecf00be155 rsx: Add color interpolation animation
- Adds color interpolation and modulation pass and refactors the code a
bit. Elements with this pass applied have their color modulated by the
animated color from the pass. Modulation transform is multiplicative.
2020-01-07 21:31:19 +03:00
kd-11 071e73a68e geometry: Allow basic color arithmetic 2020-01-07 21:31:19 +03:00
kd-11 ad845861be video: Remove pointless aspect ratio option
- The auto option is used when requesting the system is works like a
"dont care" specifier to tell the system to use what settings have been
passed in by HDMI EDID or the user TV type setting. Since this option
simulates the "TV type setting", auto makes no sense and is also not
something you can select on a PS3.
- Also adds a few missing checks.
2020-01-07 15:56:54 +03:00
Nekotekina c51779d4d3 Fix format string in log_frame.cpp 2020-01-06 23:44:48 +03:00
Nekotekina 55f9a56e45 Fix sys_tty_write (UTF-8 encoding of literals) 2020-01-06 23:23:04 +03:00
Nick Renieris 5bace118a7 overlays: Redesign animation system (add easing functions, fix bugs)
Instead of speed, direction and distance, the user now specifies
start/end offsets and how much time the transition should take.

Fixes:
- Stuttering caused from framerate estimation.
- An edge case where animations would go over their supposed limit.

Adds:
- The ability to specify arbitrary easing functions for the animations
  - Implemented quadratic ease in and ease out and cubic ease in/out.
- Usage of cubic ease in/out in the trophy notification
2020-01-06 22:42:07 +03:00
Nick Renieris 28770c1580 overlays: Move vertex & vector utility classes to new file 2020-01-06 22:42:07 +03:00
Nick Renieris 192912131e rsx: Update vblank count in LLE mode 2020-01-06 22:42:07 +03:00
Dravonic 94d2f97f27 Multithreaded shader compliation follow-up (#7190)
* Multithreaded load pipeline entries shader compliation stage

Co-authored-by: kd-11 <15904127+kd-11@users.noreply.github.com>
2020-01-06 21:59:59 +03:00
Megamouse 632cc79c54 cellGame: add more checks 2020-01-06 10:47:13 +01:00
Megamouse e7845357e2 sceNpTrophy: unlock platinum trophies 2020-01-05 19:47:31 +01:00
Nekotekina 4450ae0c7a sys_fs: fix CELL_FS_O_APPEND emulation
Don't use fs::append (not capable of).
Fix sys_fs_ftruncate (remove wrong workaround).
2020-01-05 18:15:55 +03:00
Nekotekina 9fc0aec066 sys_fs_stat: fix split file handling
Allow single-file case (consistently with sys_fs_open)
2020-01-05 18:15:55 +03:00
Nekotekina bed2d558a6 sys_fs: implement CELL_EROFS error
Implement lv2_mp_flag::read_only.
Currently only /dev_bdvd is affected.
2020-01-05 18:15:55 +03:00
Nekotekina d5f0957558 Implement lv2_fs_mount_point with mount point flags
Implement some actual mount points
Implement lv2_mp_flag::no_uid_gid
2020-01-05 18:15:43 +03:00
kd-11 7f09def94e rsx/vp: Properly initialize output registers.
- All registers tested on hw show contents to be 0, 0, 0, 1.
  Make default output registers match this pattern.
2020-01-05 18:06:08 +03:00
Silent b88fb43acc Minor cleanup in InstallPkg and InstallPup 2020-01-05 11:01:26 +01:00
Silent e7ddc5187a Add a dialog to Batch PKG Install
Dialog allows users to preview the order in which PKG's will be installed
and allows users to move items around if needed.

Because clicking "Install" on this new dialog acts as a confirmation
and user has a second chance to eyeball what is to be installed,
"Install package X?" dialogs have been removed and instead user
is only notified of success. In case of failure, batch installation
aborts with a descriptive error.
2020-01-05 11:01:26 +01:00
Eladash 872be25ed1 cellFs: Fix cellFsLseek with negative whence 2020-01-04 22:38:53 +03:00
Eladash 9d2c9e5d62 cellFs: Improve cellFsGetDirectoryEntries 2020-01-04 22:38:53 +03:00
Nekotekina 28fb0d1741 Fix lv2_fs_object::name
Recreate path from actual decoded components.
2020-01-04 21:44:03 +03:00
MSuih 5534c9e27c Disable AA for renderers which do not support it 2020-01-04 18:58:33 +01:00
MSuih 049f852a9c Slight cleanup of mousewheel pr
Fixes theoretical uninitialized variable and micro-optimizes scrollwheel stop code
2020-01-04 18:58:33 +01:00
MSuih 69f11d82d1 Change Null microphone to Disabled 2020-01-04 18:58:33 +01:00
Silent f92794360d Qt: Add tooltips to Virtual File System buttons 2020-01-04 17:10:28 +01:00
kd-11 bdb5115c7f rsx/overlays: Improve space usage on trophy dialog
- Slightly increases the size of the trophy dialog and the font size.
  The old dimensions did not work with some libre fonts causing
alignment errors and other problems.
2020-01-04 16:36:49 +03:00
kd-11 3ada97d2d3 rsx/overlays: Implement trophy notification queue
- Allows to display more than one trophy at a time. Trophy notifications
will simply get queued up and displayed at appropriate time.
2020-01-04 16:36:49 +03:00
Nekotekina 49d5ce3ba4 Update glslang.7z 2020-01-04 01:50:28 +03:00
Nekotekina 691a57a4da Add BOM to sys_tty.cpp 2020-01-04 01:32:21 +03:00
Nekotekina 671ae20876 Inject rpcs3_glslang.props to glslang build
Disable new exception format to remove vcruntime140_1.dll dependency.
2020-01-04 01:30:52 +03:00
Nekotekina 7af7e3cec1 Update ffmpeg fork URL 2020-01-03 21:54:37 +03:00
MSuih ca52c1e2d1 Link Bcrypt with ffmpeg 2020-01-03 21:45:09 +03:00
kd-11 31b07fece5 rsx/overlays: Add support for animations
- Adds animation support. This commit adds the base framework and
implements a translate animation used to slide elements around the
screen. This is then used to implement the sliding animation for the
trophy notification.
2020-01-03 20:33:32 +03:00
Megamouse b3ad89cc8b cellSaveData: remove duplicate yield 2020-01-03 14:22:40 +01:00
Megamouse 5e7d25ad35 overlays: refactor shader loading dialogs 2020-01-03 14:22:40 +01:00
Megamouse d94d094a7e overlays: fix non-interactive dialog loops 2020-01-03 14:22:40 +01:00
Megamouse c9aee27d48 VK: remove unused init function declaration 2020-01-03 14:22:40 +01:00
kd-11 d12762414a vk: Change default vertex output value
- Prefer w!=0 to avoid a situation where xyz/w = nan. More of a
theoretical problem, but some calculations break down in such a
situation.
2020-01-03 10:35:53 +03:00
kd-11 7786681954 rsx: Improve MTRSX synchronization
- Properly synchronize DMA transfers when handling RSX pipeline
barriers. Texture read barrier is used to signify completion of DMA
routines and is often used to signal that Cell can overwrite vertex
data!
2020-01-03 10:35:53 +03:00
Megamouse 02ca8f0002 Qt: repaint all related icons for custom configs 2020-01-02 11:35:51 +01:00
Megamouse 7af2ebb6f4 cellSaveData: use errDialog to skip error dialogs 2020-01-02 05:49:03 +01:00
Nekotekina 2c4ecc55af Update ffmpeg 2020-01-02 00:53:22 +03:00
kd-11 c4e59b5115 vk: Clamp depth export in FS
- PS3 matches OGL behavior where writing to the depth export
register results in clamping.
2020-01-01 22:39:20 +03:00
Eladash 4c20881f8f Fixup after #6933 (#7166)
* fixup

* Get rid of obsolute arg in lv2_obj::awake

* nvm ill do this later

* Typo fix of the decade
2020-01-01 17:38:05 +00:00
823 changed files with 79619 additions and 34827 deletions
+35
View File
@@ -0,0 +1,35 @@
#!/bin/sh -ex
ccache -s # debug
# Pull all the submodules except llvm
# Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046
git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
# XXX Drop after Travis upgrades FreeBSD to 12.2 (see also .ci/install-freebsd.sh)
case $(${CXX:-c++} --version) in
*version\ 8.0.*)
fetch https://github.com/llvm/llvm-project/releases/download/llvmorg-10.0.0/libcxx-10.0.0.src.tar.xz
tar xf libcxx-10.0.0.src.tar.xz
export CC=clang10 CXX=clang++10
export CXXFLAGS="$CXXFLAGS -nostdinc++ -isystem $PWD/libcxx-10.0.0.src/include"
;;
esac
CONFIGURE_ARGS="
-DCMAKE_C_COMPILER_LAUNCHER=ccache
-DCMAKE_CXX_COMPILER_LAUNCHER=ccache
-DWITH_LLVM=OFF
-DUSE_PRECOMPILED_HEADERS=OFF
-DUSE_NATIVE_INSTRUCTIONS=OFF
-DUSE_SYSTEM_FFMPEG=ON
-DUSE_SYSTEM_CURL=ON
-DUSE_SYSTEM_LIBPNG=ON
"
# shellcheck disable=SC2086
cmake -B build -G Ninja $CONFIGURE_ARGS
cmake --build build
ccache -s # debug
+66
View File
@@ -0,0 +1,66 @@
#!/bin/sh -ex
# Setup Qt variables
export QT_BASE_DIR=/opt/qt${QTVERMIN}
export PATH=$QT_BASE_DIR/bin:$PATH
export LD_LIBRARY_PATH=$QT_BASE_DIR/lib/x86_64-linux-gnu:$QT_BASE_DIR/lib
cd rpcs3 || exit 1
# Pull all the submodules except llvm, since it is built separately and we just download that build
# Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046
git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
# Download pre-compiled llvm libs
curl -sLO https://github.com/RPCS3/llvm-mirror/releases/download/custom-build/llvmlibs-linux.tar.gz
mkdir llvmlibs
tar -xzf ./llvmlibs-linux.tar.gz -C llvmlibs
mkdir build && cd build || exit 1
if [ "$COMPILER" = "gcc" ]; then
# These are set in the dockerfile
export CC=${GCC_BINARY}
export CXX=${GXX_BINARY}
export LINKER=gold
# We need to set the following variables for LTO to link properly
export AR=/usr/bin/gcc-ar-$GCCVER
export RANLIB=/usr/bin/gcc-ranlib-$GCCVER
export CFLAGS="-fuse-linker-plugin"
else
export CC=${CLANG_BINARY}
export CXX=${CLANGXX_BINARY}
export LINKER=lld
export AR=/usr/bin/llvm-ar-$LLVMVER
export RANLIB=/usr/bin/llvm-ranlib-$LLVMVER
fi
export CFLAGS="$CFLAGS -fuse-ld=${LINKER}"
cmake .. \
-DCMAKE_INSTALL_PREFIX=/usr \
-DBUILD_LLVM_SUBMODULE=OFF \
-DLLVM_DIR=llvmlibs/lib/cmake/llvm/ \
-DUSE_NATIVE_INSTRUCTIONS=OFF \
-DUSE_PRECOMPILED_HEADERS=OFF \
-DCMAKE_C_FLAGS="$CFLAGS" \
-DCMAKE_CXX_FLAGS="$CFLAGS" \
-DCMAKE_AR="$AR" \
-DCMAKE_RANLIB="$RANLIB" \
-G Ninja
ninja; build_status=$?;
cd ..
# If it compiled succesfully let's deploy depending on the build pipeline (Travis, Azure Pipelines).
# Travis only deploys on master, and it publishes to GitHub releases. Azure publishes PRs as artifacts
# only.
{ [ "$IS_AZURE" = "true" ] ||
{ [ "$TRAVIS_BRANCH" = "master" ] && [ "$TRAVIS_PULL_REQUEST" = "false" ]; };
} && SHOULD_DEPLOY="true" || SHOULD_DEPLOY="false"
if [ "$build_status" -eq 0 ] && [ "$SHOULD_DEPLOY" = "true" ]; then
.ci/deploy-linux.sh
fi
+10 -5
View File
@@ -1,3 +1,5 @@
#!/bin/sh -ex
export CCACHE_SLOPPINESS=pch_defines,time_macros
export CMAKE_PREFIX_PATH=/usr/local/opt/qt5/
export PATH="/usr/local/opt/ccache/libexec:$PATH"
@@ -8,15 +10,18 @@ unzip -: gfx-portability-macos-latest.zip
curl -sLO https://github.com/KhronosGroup/Vulkan-Headers/archive/sdk-1.1.106.0.zip
unzip -: sdk-*.zip
mkdir vulkan-sdk
ln -s ${PWD}/Vulkan-Headers*/include vulkan-sdk/include
ln -s "${PWD}"/Vulkan-Headers*/include vulkan-sdk/include
mkdir vulkan-sdk/lib
cp target/release/libportability.dylib vulkan-sdk/lib/libVulkan.dylib
# Let macdeployqt locate and install Vulkan library
install_name_tool -id ${PWD}/vulkan-sdk/lib/libVulkan.dylib vulkan-sdk/lib/libVulkan.dylib
export VULKAN_SDK=${PWD}/vulkan-sdk
install_name_tool -id "${PWD}"/vulkan-sdk/lib/libVulkan.dylib vulkan-sdk/lib/libVulkan.dylib
export VULKAN_SDK="${PWD}/vulkan-sdk"
git submodule update --quiet --init asmjit 3rdparty/ffmpeg 3rdparty/pugixml 3rdparty/span 3rdparty/libpng 3rdparty/cereal 3rdparty/hidapi 3rdparty/libusb 3rdparty/xxHash 3rdparty/yaml-cpp 3rdparty/FAudio Vulkan/glslang
# Pull all the submodules except llvm
# Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046
git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
mkdir build; cd build
mkdir build && cd build || exit 1
cmake .. -DWITH_LLVM=OFF -DUSE_NATIVE_INSTRUCTIONS=OFF -G Ninja
ninja
+67
View File
@@ -0,0 +1,67 @@
#!/bin/sh -ex
cd build || exit 1
if [ "$DEPLOY_APPIMAGE" = "true" ]; then
DESTDIR=appdir ninja install
QT_APPIMAGE="linuxdeployqt.AppImage"
curl -sL "https://github.com/probonopd/linuxdeployqt/releases/download/continuous/linuxdeployqt-continuous-x86_64.AppImage" > "$QT_APPIMAGE"
chmod a+x "$QT_APPIMAGE"
"./$QT_APPIMAGE" --appimage-extract
./squashfs-root/AppRun ./appdir/usr/share/applications/*.desktop -bundle-non-qt-libs
ls ./appdir/usr/lib/
rm -r ./appdir/usr/share/doc
rm ./appdir/usr/lib/libxcb*
cp "$(readlink -f /lib/x86_64-linux-gnu/libnsl.so.1)" ./appdir/usr/lib/libnsl.so.1
export PATH=/rpcs3/build/squashfs-root/usr/bin/:${PATH}
# Embed newer libstdc++ for distros that don't come with it (ubuntu 16.04)
mkdir -p appdir/usr/optional/ ; mkdir -p appdir/usr/optional/libstdc++/
cp /usr/lib/x86_64-linux-gnu/libstdc++.so.6 ./appdir/usr/optional/libstdc++/
rm ./appdir/AppRun
curl -sL https://github.com/RPCS3/AppImageKit-checkrt/releases/download/continuous2/AppRun-patched-x86_64 -o ./appdir/AppRun
chmod a+x ./appdir/AppRun
curl -sL https://github.com/RPCS3/AppImageKit-checkrt/releases/download/continuous2/exec-x86_64.so -o ./appdir/usr/optional/exec.so
# Compile checker binary for AppImageKit-checkrt
# This may need updating if you update the compiler or rpcs3 uses newer c++ features
# See https://github.com/gcc-mirror/gcc/blob/master/libstdc%2B%2B-v3/config/abi/pre/gnu.ver
# for which definitions correlate to which CXXABI version.
# Currently we target a minimum of GLIBCXX_3.4.26 and CXXABI_1.3.11
printf "#include <bits/stdc++.h>\nint main(){std::make_exception_ptr(0);std::pmr::get_default_resource();}" | $CXX -x c++ -std=c++2a -o ./appdir/usr/optional/checker -
# Package it up and send it off
./squashfs-root/usr/bin/appimagetool /rpcs3/build/appdir
ls
COMM_TAG="$(grep 'version{.*}' ../rpcs3/rpcs3_version.cpp | awk -F[\{,] '{printf "%d.%d.%d", $2, $3, $4}')"
COMM_COUNT="$(git rev-list --count HEAD)"
COMM_HASH="$(git rev-parse --short=8 HEAD)"
RPCS3_APPIMAGE="rpcs3-v${COMM_TAG}-${COMM_COUNT}-${COMM_HASH}_linux64.AppImage"
curl -sLO https://github.com/hcorion/uploadtool/raw/master/upload.sh
mv ./RPCS3*.AppImage "$RPCS3_APPIMAGE"
# If we're building using Azure Pipelines, let's copy over the AppImage artifact
if [ -n "$BUILD_ARTIFACTSTAGINGDIRECTORY" ]; then
cp "$RPCS3_APPIMAGE" ~/artifacts
fi
FILESIZE=$(stat -c %s ./rpcs3*.AppImage)
SHA256SUM=$(sha256sum ./rpcs3*.AppImage)
if [ -n "$GITHUB_TOKEN" ]; then
unset TRAVIS_REPO_SLUG
REPO_SLUG=RPCS3/rpcs3-binaries-linux \
UPLOADTOOL_BODY="$SHA256SUM;${FILESIZE}B"\
RELEASE_NAME=build-${TRAVIS_COMMIT}\
RELEASE_TITLE=${COMM_TAG}-${COMM_COUNT}\
REPO_COMMIT=d812f1254a1157c80fd402f94446310560f54e5f\
bash upload.sh rpcs3*.AppImage
fi
fi
if [ "$DEPLOY_PPA" = "true" ]; then
export DEBFULLNAME="RPCS3 Build Bot"
fi
+24
View File
@@ -0,0 +1,24 @@
#!/bin/sh -ex
# BUILD_blablabla is Azure specific, so we wrap it for portability
ARTIFACT_DIR="$BUILD_ARTIFACTSTAGINGDIRECTORY"
# Remove unecessary files
rm -f ./bin/rpcs3.exp ./bin/rpcs3.lib ./bin/rpcs3.pdb
# Prepare compatibility database for packaging, as well as
# certificate for ssl (auto-updater)
curl -sL 'https://rpcs3.net/compatibility?api=v1&export' | iconv -t UTF-8 > ./bin/GuiConfigs/compat_database.dat
curl -sL 'https://curl.haxx.se/ca/cacert.pem' > ./bin/cacert.pem
# Package artifacts
7z a -m0=LZMA2 -mx9 "$BUILD" ./bin/*
# Generate sha256 hashes
# Write to file for GitHub releases
sha256sum "$BUILD" | awk '{ print $1 }' | tee "$BUILD.sha256"
echo "$(cat "$BUILD.sha256");$(stat -c %s "$BUILD")B" > GitHubReleaseMessage.txt
# Move files to publishing directory
mv -- "$BUILD" "$ARTIFACT_DIR"
mv -- "$BUILD.sha256" "$ARTIFACT_DIR"
+13
View File
@@ -0,0 +1,13 @@
#!/bin/sh -e
# Export variables for later stages of the Azure pipeline
# Values done in this manner will appear as environment variables
# in later stages.
# From pure-sh-bible
# Setting 'IFS' tells 'read' where to split the string.
while IFS='=' read -r key val; do
# Skip over lines containing comments.
[ "${key##\#*}" ] || continue
echo "##vso[task.setvariable variable=$key]$val"
done < ".ci/azure-vars.env"
+4
View File
@@ -0,0 +1,4 @@
#!/bin/sh -ex
curl -L -o "./llvm.lock" "https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z.sha256"
curl -L -o "./glslang.lock" "https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z.sha256"
+44
View File
@@ -0,0 +1,44 @@
#!/bin/sh -ex
ARTIFACT_DIR="$BUILD_ARTIFACTSTAGINGDIRECTORY"
generate_post_data()
{
body=$(cat GitHubReleaseMessage.txt)
cat <<EOF
{
"tag_name": "build-${BUILD_SOURCEVERSION}",
"target_commitish": "7d09e3be30805911226241afbb14f8cdc2eb054e",
"name": "${AVVER}",
"body": "$body",
"draft": false,
"prerelease": false
}
EOF
}
repo_full_name="RPCS3/rpcs3-binaries-win"
curl -s \
-H "Authorization: token ${RPCS3_TOKEN}" \
-H "Accept: application/vnd.github.v3+json" \
--data "$(generate_post_data)" "https://api.github.com/repos/$repo_full_name/releases" >> release.json
cat release.json
id=$(grep '"id"' release.json | cut -d ':' -f2 | head -n1 | awk '{$1=$1;print}')
id=${id%?}
echo ${id:?}
upload_file()
{
curl -s \
-H "Authorization: token ${RPCS3_TOKEN}" \
-H "Accept: application/vnd.github.v3+json" \
-H "Content-Type: application/octet-stream" \
--data-binary @"$2"/"$3" \
"https://uploads.github.com/repos/$repo_full_name/releases/$1/assets?name=$3"
}
for file in "$ARTIFACT_DIR"/*; do
name=$(basename "$file")
upload_file "$id" "$ARTIFACT_DIR" "$name"
done
+22
View File
@@ -0,0 +1,22 @@
#!/usr/bin/env -S su -m root -ex
# NOTE: this script is run under root permissions
# shellcheck shell=sh disable=SC2096
# RPCS3 often needs recent Qt5 and Vulkan-Headers
sed -i '' 's/quarterly/latest/' /etc/pkg/FreeBSD.conf
export ASSUME_ALWAYS_YES=true
pkg info # debug
# XXX Drop after Travis upgrades FreeBSD to 12.2 (see also .ci/build-freebsd.sh)
case $(${CXX:-c++} --version) in
*version\ 8.0.*)
pkg install llvm10
;;
esac
# Mandatory dependencies (qt5-dbus and qt5-gui are pulled via qt5-widgets)
pkg install git ccache cmake ninja qt5-qmake qt5-buildtools qt5-widgets qt5-concurrent glew openal-soft ffmpeg
# Optional dependencies (libevdev is pulled by qt5-gui)
pkg install pkgconf alsa-lib pulseaudio sdl2 evdev-proto vulkan-headers vulkan-loader
+116
View File
@@ -0,0 +1,116 @@
#!/bin/sh -ex
# These are Azure specific, so we wrap them for portability
REPO_NAME="$BUILD_REPOSITORY_NAME"
REPO_BRANCH="$SYSTEM_PULLREQUEST_SOURCEBRANCH"
PR_NUMBER="$SYSTEM_PULLREQUEST_PULLREQUESTID"
# Resource/dependency URLs
# Qt mirrors can be volatile and slow, so we list 2
QT_HOST="http://mirrors.ocf.berkeley.edu/qt/"
#QT_HOST="http://qt.mirror.constant.com/"
QT_URL_VER=$(echo "$QT_VER" | sed "s/\.//g")
QT_PREFIX="online/qtsdkrepository/windows_x86/desktop/qt5_${QT_URL_VER}/qt.qt5.${QT_URL_VER}.win64_msvc2017_64/${QT_VER}-0-${QT_DATE}"
QT_SUFFIX="-Windows-Windows_10-MSVC2017-Windows-Windows_10-X86_64.7z"
QT_BASE_URL="${QT_HOST}${QT_PREFIX}qtbase${QT_SUFFIX}"
QT_WINE_URL="${QT_HOST}${QT_PREFIX}qtwinextras${QT_SUFFIX}"
QT_DECL_URL="${QT_HOST}${QT_PREFIX}qtdeclarative${QT_SUFFIX}"
QT_TOOL_URL="${QT_HOST}${QT_PREFIX}qttools${QT_SUFFIX}"
LLVMLIBS_URL='https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z'
#GLSLANG_URL='https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z' <- Temporarily disabled auto-builds
GLSLANG_URL='https://www.dropbox.com/s/cg48qr4zmnn066v/glslanglibs_mt.7z'
VULKAN_SDK_URL="https://www.dropbox.com/s/adanclixregbp2x/VulkanSDK-${VULKAN_VER}-Installer.exe"
DEP_URLS=" \
$QT_BASE_URL \
$QT_WINE_URL \
$QT_DECL_URL \
$QT_TOOL_URL \
$LLVMLIBS_URL \
$GLSLANG_URL \
$VULKAN_SDK_URL"
# Azure pipelines doesn't make a cache dir if it doesn't exist, so we do it manually
[ -d "$CACHE_DIR" ] || mkdir "$CACHE_DIR"
# Pull all the submodules except llvm, since it is built separately and we just download that build
# Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046
git submodule -q update --init --depth 1 $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
# Git bash doesn't have rev, so here it is
rev()
{
echo "$1" | awk '{ for(i = length($0); i != 0; --i) { a = a substr($0, i, 1); } } END { print a }'
}
# Usage: download_and_verify url checksum algo file
# Check to see if a file is already cached, and the checksum matches. If not, download it.
# Tries up to 3 times
download_and_verify()
{
url="$1"
correctChecksum="$2"
algo="$3"
fileName="$4"
for _ in 1 2 3; do
[ -e "$CACHE_DIR/$fileName" ] || curl -L -o "$CACHE_DIR/$fileName" "$url"
fileChecksum=$("${algo}sum" "$CACHE_DIR/$fileName" | awk '{ print $1 }')
[ "$fileChecksum" = "$correctChecksum" ] && return 0
rm "$CACHE_DIR/$fileName"
done
return 1;
}
# Some dependencies install here
[ -d "./lib" ] || mkdir "./lib"
for url in $DEP_URLS; do
# Get the filename from the URL. Breaks if urls have js args, so don't do that pls
fileName="$(rev "$(rev "$url" | cut -d'/' -f1)")"
[ -z "$fileName" ] && echo "Unable to parse url: $url" && exit 1
# shellcheck disable=SC1003
case "$url" in
*qt*) checksum=$(curl -L "${url}.sha1"); algo="sha1"; outDir='C:\Qt\' ;;
*llvm*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="." ;;
#*glslang*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="./lib/Release - LLVM-x64" ;; <- Temporarily disabled auto-build
*glslang*) checksum=$(curl -L 'https://www.dropbox.com/s/hwnatk68n70jap0/glslanglibs_mt.7z.sha256'); algo="sha256"; outDir="./lib/Release - LLVM-x64" ;;
*Vulkan*)
# Vulkan setup needs to be run in batch environment
# Need to subshell this or else it doesn't wait
download_and_verify "$url" "$VULKAN_SDK_SHA" "sha256" "$fileName"
cp "$CACHE_DIR/$fileName" .
_=$(echo "$fileName /S" | cmd)
continue
;;
*) echo "Unknown url resource: $url"; exit 1 ;;
esac
download_and_verify "$url" "$checksum" "$algo" "$fileName"
7z x -y "$CACHE_DIR/$fileName" -aos -o"$outDir"
done
# Gather explicit version number and number of commits
COMM_TAG=$(awk '/version{.*}/ { printf("%d.%d.%d", $5, $6, $7) }' ./rpcs3/rpcs3_version.cpp)
COMM_COUNT=$(git rev-list --count HEAD)
COMM_HASH=$(git rev-parse --short=8 HEAD)
# Format the above into filenames
if [ -n "$PR_NUMBER" ]; then
AVVER="${COMM_TAG}-${COMM_HASH}"
BUILD="rpcs3-v${AVVER}_win64.7z"
else
AVVER="${COMM_TAG}-${COMM_COUNT}"
BUILD="rpcs3-v${AVVER}-${COMM_HASH}_win64.7z"
fi
# BRANCH is used for experimental build warnings for pr builds, used in main_window.cpp.
# BUILD is the name of the release artifact
# AVVER is used for GitHub releases, it is the version number.
BRANCH="${REPO_NAME}/${REPO_BRANCH}"
echo "BRANCH=$BRANCH" > .ci/azure-vars.env
echo "BUILD=$BUILD" >> .ci/azure-vars.env
echo "AVVER=$AVVER" >> .ci/azure-vars.env
+7
View File
@@ -2,6 +2,13 @@
TRAVIS_PULL_REQUEST
TRAVIS_BRANCH
TRAVIS_COMMIT
# Variables set by Azure Pipelines
IS_AZURE
BUILD_REASON
BUILD_SOURCEVERSION
BUILD_ARTIFACTSTAGINGDIRECTORY
BUILD_REPOSITORY_NAME
BUILD_SOURCEBRANCHNAME
# Variables for Travis build matrix
COMPILER
DEPLOY_APPIMAGE
+19
View File
@@ -0,0 +1,19 @@
env:
CIRRUS_CLONE_DEPTH: 0 # Unshallow clone to obtain proper GIT_VERSION
freebsd_task:
matrix:
- name: FreeBSD 12.2 (snapshot)
freebsd_instance:
image_family: freebsd-12-1-snap
cpu: 8
memory: 8G
env:
CCACHE_MAXSIZE: 300M # 3x clean build, rounded
CCACHE_DIR: /tmp/ccache_dir
ccache_cache:
folder: /tmp/ccache_dir
packages_cache:
folder: /var/cache/pkg
install_script: "sh -ex ./.ci/install-freebsd.sh"
script: "./.ci/build-freebsd.sh"
-24
View File
@@ -1,24 +0,0 @@
<!---
THIS IS NOT A SUPPORT FORUM, FOR SUPPORT GO TO:
https://forums.rpcs3.net
or our discord:
https://discord.me/RPCS3
PLEASE READ THE GUIDELINES BEFORE OPENING AN ISSUE:
https://github.com/RPCS3/rpcs3/blob/master/.github/CONTRIBUTING.md
====================================================
When submitting an issue, please check the following:
- You have read the above.
- You have provided the version (commit hash) of RPCS3 you are using.
- You have provided sufficient detail for the issue to be reproduced.
- You have provided system specs.
- Please also provide:
- For crashes, a backtrace.
- For graphical issues, comparison screenshots with real hardware.
Remember that the GitHub Issue Tracker is not the place to ask for support or to submit Game Compatibility reports. You must use our forums for that.
--->
@@ -0,0 +1,62 @@
---
name: Regression report
about: If something used to work before, but now it doesn't
title: ''
labels: ''
assignees: ''
---
## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
## Quick summary
Please briefly describe what has stopped working correctly.
## Details
Please describe the regression as accurately as possible.
#### 1. Please provide _exact_ build (or commit) information that introduced the regression you're reporting.
* Please see [How to find the build that caused a regression](https://wiki.rpcs3.net/index.php?title=Help:Using_different_versions_of_RPCS3#How_to_find_the_build_that_caused_a_regression.3F) in our wiki.
* You can find [History of RPCS3 builds](https://rpcs3.net/compatibility?b) here.
#### 2. Please attach TWO logs:
* One for the build with regression.
* One for the build that works as expected.
##### How to obtain RPCS3's log:
* Run the game until you find the regression.
* Completely close RPCS3, or move to the next step in case it has crashed.
* Locate RPCS3's log file:
+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
or
+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
On Linux it will be in ```~/.cache/rpcs3/```.
On Windows it will be near the executable.
* Attach the log:
+ Drag and drop your log file into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
#### 3. If you describe graphical regression, please provide an RSX capture and a RenderDoc capture that demonstrate it.
* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
Captures will be stored in RPCS3 folder → captures.
+ Compress your capture with 7z, Rar etc.
And drag and drop it into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
#### 4. Please attach screenshots of your problem.
* Enable performance overlay with at least medium level of detail.
You can find it in _Emulator_ tab in _Settings_.
#### 5. Please provide comparison with real PS3.
#### 6. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
+55
View File
@@ -0,0 +1,55 @@
---
name: Bug report
about: If something doesn't work correctly in RPCS3
title: ''
labels: ''
assignees: ''
---
## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
## Quick summary
Please briefly describe what is not working correctly.
## Details
Please describe the problem as accurately as possible.
#### 1. Please attach RPCS3's log.
* Run the game until you find the issue.
* Completely close RPCS3, or move to the next step in case it has crashed.
* Locate RPCS3's log file:
+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
or
+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
On Linux it will be in ```~/.cache/rpcs3/```.
On Windows it will be near the executable.
* Attach the log:
+ Drag and drop your log file into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
#### 2. If you describe graphical issue, please provide an RSX capture and a RenderDoc capture that demonstrate it.
* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
Captures will be stored in RPCS3 folder → captures.
+ Compress your capture with 7z, Rar etc.
And drag and drop it into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
#### 3. Please attach screenshots of your problem.
* Enable performance overlay with at least medium level of detail.
You can find it in _Emulator_ tab in _Settings_.
#### 4. Please provide comparison with real PS3.
#### 5. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
@@ -0,0 +1,41 @@
---
name: Feature Request
about: If RPCS3 lacks a feature you would like to see
title: '[Feature Request] Enter Feature Title Here'
labels: ''
assignees: ''
---
## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
## Quick summary
Please briefly describe what feature you would like RPCS3 to have.
## Details
Please describe the feature as accurately as possible.
#### 1. Please describe, what part of RPCS3 would be affected by your feature:
* Gameplay
* Debugging
* UI
* Patches
* Installation
* Github
* CI
* etc.
#### 2. Please tell us, why your feature is important to RPCS3.
#### 3. Please attach screenshots of the feature implemented in other projects.
#### 4. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
+11
View File
@@ -0,0 +1,11 @@
blank_issues_enabled: false
contact_links:
- name: Quickstart guide
url: https://rpcs3.net/quickstart
about: Everything you need to know to install and configure emulator, and add games
- name: Ask for help
url: https://discord.me/RPCS3
about: If you have some questions or need help, please use our Discord server instead of GitHub
- name: Report game compatibility
url: https://forums.rpcs3.net/thread-196671.html
about: Please use RPCS3 forums to submit or update game compatibility status
+17
View File
@@ -37,8 +37,10 @@
/rpcs3/Debug
/rpcs3/Release
/llvm_build
/3rdparty/llvm_build
/Vulkan/Vulkan-build
/Vulkan/glslang-build
/Vulkan/spirv-tools-build
!/bin
/bin/*
@@ -71,10 +73,15 @@ Makefile
*CMakeFiles*
CMakeCache.txt
*cmake_install.cmake*
CPackConfig.cmake
CPackSourceConfig.cmake
compile_commands.json
# cotire
rpcs3/cotire/*
rpcs3/rpcs3_*_cotire.cmake
rpcs3/Emu/rpcs3_emu_CXX_Release_cotire.cmake
rpcs3/Emu/rpcs3_emu_CXX_cotire.cmake
# kdevelop
*.kdev4
@@ -99,3 +106,13 @@ CMakeLists.txt.user
# 7zlib
/3rdparty/7z/**/*.lib
# yaml-cpp
yaml-cpp.pc
# libusb
/3rdparty/libusb_cmake/config.h
/3rdparty/libusb_cmake/libusb-1.0.pc
# ssl certificate
cacert.pem
+26 -6
View File
@@ -1,6 +1,6 @@
[submodule "rpcs3-ffmpeg"]
path = 3rdparty/ffmpeg
url = https://github.com/hrydgard/ppsspp-ffmpeg
url = https://github.com/RPCS3/ffmpeg-core
ignore = dirty
[submodule "asmjit"]
path = asmjit
@@ -8,16 +8,23 @@
ignore = dirty
[submodule "llvm"]
path = llvm
url = https://github.com/RPCS3/llvm
branch = release_60
url = https://github.com/RPCS3/llvm-mirror
ignore = dirty
[submodule "Vulkan/glslang"]
path = Vulkan/glslang
url = https://github.com/KhronosGroup/glslang.git
ignore = dirty
[submodule "Vulkan/spirv-tools"]
path = Vulkan/spirv-tools
url = https://github.com/KhronosGroup/SPIRV-Tools.git
ignore = dirty
[submodule "Vulkan/spirv-headers"]
path = Vulkan/spirv-headers
url = https://github.com/KhronosGroup/SPIRV-Headers.git
ignore = dirty
[submodule "3rdparty/cereal"]
path = 3rdparty/cereal
url = https://github.com/USCiLab/cereal.git
url = https://github.com/RPCS3/cereal.git
ignore = dirty
[submodule "3rdparty/zlib"]
path = 3rdparty/zlib
@@ -38,7 +45,7 @@
ignore = dirty
[submodule "3rdparty/yaml-cpp"]
path = 3rdparty/yaml-cpp
url = https://github.com/jbeder/yaml-cpp.git
url = https://github.com/RPCS3/yaml-cpp.git
ignore = dirty
[submodule "3rdparty/libpng"]
path = 3rdparty/libpng
@@ -46,7 +53,7 @@
ignore = dirty
[submodule "3rdparty/libusb"]
path = 3rdparty/libusb
url = https://github.com/RPCS3/libusb.git
url = https://github.com/libusb/libusb.git
ignore = dirty
[submodule "3rdparty/FAudio"]
path = 3rdparty/FAudio
@@ -55,3 +62,16 @@
[submodule "3rdparty/span"]
path = 3rdparty/span
url = https://github.com/tcbrindle/span
ignore = dirty
[submodule "3rdparty/curl"]
path = 3rdparty/curl
url = https://github.com/RipleyTom/curl.git
ignore = dirty
[submodule "3rdparty/wolfssl"]
path = 3rdparty/wolfssl
url = https://github.com/RipleyTom/wolfssl.git
ignore = dirty
[submodule "3rdparty/flatbuffers"]
path = 3rdparty/flatbuffers
url = https://github.com/google/flatbuffers.git
ignore = dirty
-3
View File
@@ -1,3 +0,0 @@
{
"userBlacklist": ["AlexAltea", "tambry", "DHrpcs3"]
}
+32 -27
View File
@@ -1,40 +1,45 @@
language: cpp
matrix:
jobs:
include:
# - os: linux
# env:
# - NAME="Linux build"
# - COMPILER="gcc"
# services: docker
# cache: ccache
# install: "docker pull rpcs3/rpcs3-travis-xenial:1.0"
# script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .travis/travis.env rpcs3/rpcs3-travis-xenial:1.0 /bin/bash -ex /rpcs3/.travis/build-linux.bash'
- os: linux
dist: xenial
env:
- NAME="Linux build"
- COMPILER="gcc"
- DEPLOY_APPIMAGE="true"
services: docker
cache: ccache
compiler: gcc
install: "docker pull rpcs3/rpcs3-travis-xenial:1.5"
script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.5 /rpcs3/.ci/build-linux.sh'
- os: linux
dist: xenial
env:
- NAME="Linux build"
- COMPILER="clang"
- DEPLOY_APPIMAGE="true"
services: docker
cache: ccache
install: "docker pull rpcs3/rpcs3-travis-xenial:1.0"
addons:
apt:
packages:
- libsdl2-2.0
- libsdl2-dev
script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .travis/travis.env rpcs3/rpcs3-travis-xenial:1.0 /bin/bash -ex /rpcs3/.travis/build-linux.bash'
compiler: clang
install: "docker pull rpcs3/rpcs3-travis-xenial:1.5"
script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.5 /rpcs3/.ci/build-linux.sh'
# - os: freebsd
# compiler: clang
# cache: ccache
# install: "./.ci/install-freebsd.sh"
# script: "./.ci/build-freebsd.sh"
# - os: osx
# osx_image: xcode11.3
# addons:
# homebrew:
# packages:
# - ccache
# - glew
# - ninja
# - qt
# script: "/bin/bash -ex .ci/build-mac.sh"
# cache: ccache
allow_failures:
- os: osx
osx_image: xcode10.2
addons:
homebrew:
packages:
- ccache
- glew
- ninja
- qt
script: "/bin/bash -ex .travis/build-mac.bash"
cache: ccache
git:
depth: false # Unshallow clone to obtain proper GIT_VERSION
-35
View File
@@ -1,35 +0,0 @@
#!/bin/env bash -ex
shopt -s nocasematch
# Setup Qt variables
export QT_BASE_DIR=/opt/qt${QTVERMIN}
export PATH=$QT_BASE_DIR/bin:$PATH
export LD_LIBRARY_PATH=$QT_BASE_DIR/lib/x86_64-linux-gnu:$QT_BASE_DIR/lib
cd rpcs3
git submodule update --quiet --init asmjit 3rdparty/ffmpeg 3rdparty/pugixml 3rdparty/span 3rdparty/libpng 3rdparty/cereal 3rdparty/hidapi 3rdparty/xxHash 3rdparty/yaml-cpp 3rdparty/libusb 3rdparty/FAudio Vulkan/glslang
# Download pre-compiled llvm libs
curl -sLO https://github.com/RPCS3/llvm/releases/download/continuous-linux-master/llvmlibs-linux.tar.gz
mkdir llvmlibs
tar -xzf ./llvmlibs-linux.tar.gz -C llvmlibs
mkdir build ; cd build
if [ $COMPILER = "gcc" ]; then
# These are set in the dockerfile
export CC=${GCC_BINARY}
export CXX=${GXX_BINARY}
else
export CC=${CLANG_BINARY}
export CXX=${CLANGXX_BINARY}
fi
cmake .. -DCMAKE_INSTALL_PREFIX=/usr -DBUILD_LLVM_SUBMODULE=OFF -DLLVM_DIR=llvmlibs/lib/cmake/llvm/ -DUSE_NATIVE_INSTRUCTIONS=OFF -G Ninja
ninja; build_status=$?;
cd ..
# If it compiled succesfully let's deploy
if [ $build_status -eq 0 ] && [ -n "$GITHUB_TOKEN" ] && [ "$TRAVIS_BRANCH" = "master" ] && [ "$TRAVIS_PULL_REQUEST" = false ]; then /bin/bash -ex .travis/deploy-linux.bash ; fi
-53
View File
@@ -1,53 +0,0 @@
#!/bin/env bash -ex
shopt -s nocasematch
cd build
if [ "$DEPLOY_APPIMAGE" = "true" ]; then
DESTDIR=appdir ninja install
curl -sLO "https://github.com/probonopd/linuxdeployqt/releases/download/continuous/linuxdeployqt-continuous-x86_64.AppImage"
chmod a+x linuxdeployqt*.AppImage
./linuxdeployqt*.AppImage --appimage-extract
./squashfs-root/AppRun ./appdir/usr/share/applications/*.desktop -bundle-non-qt-libs
ls ./appdir/usr/lib/
rm -r ./appdir/usr/share/doc
rm ./appdir/usr/lib/libxcb*
cp $(readlink -f /lib/x86_64-linux-gnu/libnsl.so.1) ./appdir/usr/lib/libnsl.so.1
export PATH=/rpcs3/build/squashfs-root/usr/bin/:${PATH}
# Embed newer libstdc++ for distros that don't come with it (ubuntu 16.04)
mkdir -p appdir/usr/optional/ ; mkdir -p appdir/usr/optional/libstdc++/
cp /usr/lib/x86_64-linux-gnu/libstdc++.so.6 ./appdir/usr/optional/libstdc++/
rm ./appdir/AppRun
curl -sL https://github.com/RPCS3/AppImageKit-checkrt/releases/download/continuous2/AppRun-patched-x86_64 -o ./appdir/AppRun
chmod a+x ./appdir/AppRun
curl -sL https://github.com/RPCS3/AppImageKit-checkrt/releases/download/continuous2/exec-x86_64.so -o ./appdir/usr/optional/exec.so
# Compile checker binary for AppImageKit-checkrt
# This may need updating if you update the compiler or rpcs3 uses newer c++ features
# See https://github.com/gcc-mirror/gcc/blob/master/libstdc%2B%2B-v3/config/abi/pre/gnu.ver
# for which definitions correlate to which CXXABI version.
printf "#include <memory>\nint main(){std::make_exception_ptr(0);}" | $CXX -x c++ -o ./appdir/usr/optional/checker -
# Package it up and send it off
./squashfs-root/usr/bin/appimagetool /rpcs3/build/appdir
ls
COMM_TAG="$(grep 'version{.*}' ../rpcs3/rpcs3_version.cpp | awk -F[{,] '{printf "%d.%d.%d", $2, $3, $4}')"
COMM_COUNT="$(git rev-list --count HEAD)"
curl -sLO https://github.com/hcorion/uploadtool/raw/master/upload.sh
mv ./RPCS3*.AppImage rpcs3-v${COMM_TAG}-${COMM_COUNT}-${TRAVIS_COMMIT:0:8}_linux64.AppImage
FILESIZE=($(stat -c %s ./rpcs3*.AppImage))
SHA256SUM=($(sha256sum ./rpcs3*.AppImage))
unset TRAVIS_REPO_SLUG
REPO_SLUG=RPCS3/rpcs3-binaries-linux \
UPLOADTOOL_BODY="$SHA256SUM;${FILESIZE}B"\
RELEASE_NAME=build-${TRAVIS_COMMIT}\
RELEASE_TITLE=${COMM_TAG}-${COMM_COUNT}\
REPO_COMMIT=d812f1254a1157c80fd402f94446310560f54e5f\
bash upload.sh rpcs3*.AppImage
fi
if [ "$DEPLOY_PPA" = "true" ]; then
export DEBFULLNAME="RPCS3 Build Bot"
fi
+3 -1
View File
@@ -111,6 +111,9 @@
</PropertyGroup>
<Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<Import Project="..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|Win32'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType>
@@ -204,7 +207,6 @@
</ItemDefinitionGroup>
<ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<ClCompile>
<PrecompiledHeader>Use</PrecompiledHeader>
<WarningLevel>Level3</WarningLevel>
<Optimization>Disabled</Optimization>
<SDLCheck>true</SDLCheck>
+40 -20
View File
@@ -1,14 +1,6 @@
find_package(PkgConfig)
include(ExternalProject)
if(APPLE)
set(PLATFORM_ARCH "macosx/x86_64")
elseif(WIN32)
set(PLATFORM_ARCH "Windows/x86_64")
else()
set(PLATFORM_ARCH "linux/x86_64")
endif()
# Dummy target to use when lib isn't available
add_library(3rdparty_dummy_lib INTERFACE)
@@ -82,6 +74,9 @@ else()
add_library(3rdparty_7z INTERFACE)
endif()
add_library(3rdparty_flatbuffers INTERFACE)
target_include_directories(3rdparty_flatbuffers INTERFACE flatbuffers/include)
# libPNG
# Select the version of libpng to use, default is builtin
if (NOT USE_SYSTEM_LIBPNG)
@@ -146,9 +141,9 @@ if(CMAKE_SYSTEM MATCHES "DragonFly|FreeBSD")
elseif(MSVC)
# Windows time.h defines timespec but doesn't add any flag for it, which makes libusb attempt to define it again
add_definitions(-DHAVE_STRUCT_TIMESPEC=1)
add_subdirectory(libusb EXCLUDE_FROM_ALL)
add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
else()
add_subdirectory(libusb EXCLUDE_FROM_ALL)
add_subdirectory(libusb_cmake EXCLUDE_FROM_ALL)
endif()
@@ -305,7 +300,7 @@ if(USE_VULKAN)
if(VULKAN_FOUND)
add_library(3rdparty_vulkan INTERFACE)
target_compile_definitions(3rdparty_vulkan INTERFACE -DHAVE_VULKAN)
target_link_libraries(3rdparty_vulkan INTERFACE SPIRV Vulkan::Vulkan)
target_link_libraries(3rdparty_vulkan INTERFACE SPIRV SPIRV-Tools-opt Vulkan::Vulkan)
if(UNIX AND NOT APPLE)
find_package(Wayland)
@@ -345,6 +340,7 @@ if(USE_FAUDIO)
if (NOT SDL2_FOUND OR SDL2_VERSION VERSION_LESS 2.0.9)
message("-- RPCS3: FAudio requires SDL 2.0.9 or newer.")
else()
set(BUILD_SHARED_LIBS OFF CACHE BOOL "Build shared library")
add_subdirectory(FAudio EXCLUDE_FROM_ALL)
target_compile_definitions(FAudio INTERFACE -DHAVE_FAUDIO)
set(FAUDIO_TARGET FAudio)
@@ -362,8 +358,6 @@ if(USE_SYSTEM_FFMPEG)
target_include_directories(3rdparty_ffmpeg INTERFACE ${FFMPEG_INCLUDE_DIR})
target_link_libraries(3rdparty_ffmpeg INTERFACE ${FFMPEG_LIBRARIES})
else()
set(FFMPEG_PLATFORM_DIR "ffmpeg/${PLATFORM_ARCH}")
if (NOT MSVC AND WIN32)
message("-- RPCS3: building ffmpeg submodule")
@@ -371,26 +365,36 @@ else()
DOWNLOAD_COMMAND ""
SOURCE_DIR ${CMAKE_CURRENT_SOURCE_DIR}/ffmpeg
BINARY_DIR ${CMAKE_CURRENT_BINARY_DIR}/ffmpeg
CONFIGURE_COMMAND ${CMAKE_CURRENT_SOURCE_DIR}/ffmpeg/configure --prefix=./Windows/x86_64 --arch=x86_64 --disable-avdevice --disable-programs --disable-avfilter --disable-postproc --disable-doc --disable-pthreads --enable-w32threads --disable-network --disable-everything --disable-encoders --disable-muxers --disable-hwaccels --disable-parsers --disable-protocols --enable-dxva2 --enable-static --disable-shared --enable-decoder=aac --enable-decoder=aac_latm --enable-decoder=atrac3 --enable-decoder=atrac3p --enable-decoder=mp3 --enable-decoder=pcm_s16le --enable-decoder=pcm_s8 --enable-decoder=h264 --enable-decoder=mpeg4 --enable-decoder=mpeg2video --enable-decoder=mjpeg --enable-decoder=mjpegb --enable-encoder=pcm_s16le --enable-encoder=ffv1 --enable-encoder=mpeg4 --enable-parser=h264 --enable-parser=mpeg4video --enable-parser=mpegaudio --enable-parser=mpegvideo --enable-parser=mjpeg --enable-parser=aac --enable-parser=aac_latm --enable-muxer=avi --enable-demuxer=h264 --enable-demuxer=m4v --enable-demuxer=mp3 --enable-demuxer=mpegvideo --enable-demuxer=mpegps --enable-demuxer=mjpeg --enable-demuxer=avi --enable-demuxer=aac --enable-demuxer=pmp --enable-demuxer=oma --enable-demuxer=pcm_s16le --enable-demuxer=pcm_s8 --enable-demuxer=wav --enable-hwaccel=h264_dxva2 --enable-indev=dshow --enable-protocol=file
CONFIGURE_COMMAND ${CMAKE_CURRENT_SOURCE_DIR}/ffmpeg/configure --prefix=./windows/x86_64 --arch=x86_64 --disable-avdevice --disable-programs --disable-avfilter --disable-postproc --disable-doc --disable-pthreads --enable-w32threads --disable-network --disable-everything --disable-encoders --disable-muxers --disable-hwaccels --disable-parsers --disable-protocols --enable-dxva2 --enable-static --disable-shared --enable-decoder=aac --enable-decoder=aac_latm --enable-decoder=atrac3 --enable-decoder=atrac3p --enable-decoder=mp3 --enable-decoder=pcm_s16le --enable-decoder=pcm_s8 --enable-decoder=h264 --enable-decoder=mpeg4 --enable-decoder=mpeg2video --enable-decoder=mjpeg --enable-decoder=mjpegb --enable-encoder=pcm_s16le --enable-encoder=ffv1 --enable-encoder=mpeg4 --enable-parser=h264 --enable-parser=mpeg4video --enable-parser=mpegaudio --enable-parser=mpegvideo --enable-parser=mjpeg --enable-parser=aac --enable-parser=aac_latm --enable-muxer=avi --enable-demuxer=h264 --enable-demuxer=m4v --enable-demuxer=mp3 --enable-demuxer=mpegvideo --enable-demuxer=mpegps --enable-demuxer=mjpeg --enable-demuxer=avi --enable-demuxer=aac --enable-demuxer=pmp --enable-demuxer=oma --enable-demuxer=pcm_s16le --enable-demuxer=pcm_s8 --enable-demuxer=wav --enable-hwaccel=h264_dxva2 --enable-indev=dshow --enable-protocol=file
BUILD_COMMAND make -j 4
INSTALL_COMMAND make install
)
set(FFMPEG_LIB_AVFORMAT "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/${PLATFORM_ARCH}/lib/libavformat.a")
set(FFMPEG_LIB_AVCODEC "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/${PLATFORM_ARCH}/lib/libavcodec.a")
set(FFMPEG_LIB_AVUTIL "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/${PLATFORM_ARCH}/lib/libavutil.a")
set(FFMPEG_LIB_SWSCALE "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/${PLATFORM_ARCH}/lib/libswscale.a")
set(FFMPEG_LIB_AVFORMAT "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/windows/x86_64/lib/libavformat.a")
set(FFMPEG_LIB_AVCODEC "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/windows/x86_64/lib/libavcodec.a")
set(FFMPEG_LIB_AVUTIL "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/windows/x86_64/lib/libavutil.a")
set(FFMPEG_LIB_SWSCALE "${CMAKE_CURRENT_BINARY_DIR}/ffmpeg/windows/x86_64/lib/libswscale.a")
else()
message("-- RPCS3: using builtin ffmpeg")
set(FFMPEG_LIB_DIR "${FFMPEG_PLATFORM_DIR}/lib")
if (WIN32)
set(FFMPEG_LIB_DIR "ffmpeg/windows/x86_64")
target_link_libraries(3rdparty_ffmpeg INTERFACE "Bcrypt.lib")
elseif(CMAKE_SYSTEM MATCHES "Linux")
set(FFMPEG_LIB_DIR "ffmpeg/linux/x86_64")
elseif(APPLE)
set(FFMPEG_LIB_DIR "ffmpeg/macos/x86_64")
else()
message(FATAL_ERROR "Prebuilt ffmpeg is not available on this platform! Try USE_SYSTEM_FFMPEG=ON.")
endif()
find_library(FFMPEG_LIB_AVFORMAT avformat PATHS ${FFMPEG_LIB_DIR} NO_DEFAULT_PATH)
find_library(FFMPEG_LIB_AVCODEC avcodec PATHS ${FFMPEG_LIB_DIR} NO_DEFAULT_PATH)
find_library(FFMPEG_LIB_AVUTIL avutil PATHS ${FFMPEG_LIB_DIR} NO_DEFAULT_PATH)
find_library(FFMPEG_LIB_SWSCALE swscale PATHS ${FFMPEG_LIB_DIR} NO_DEFAULT_PATH)
endif()
target_include_directories(3rdparty_ffmpeg INTERFACE "${FFMPEG_PLATFORM_DIR}/include")
target_include_directories(3rdparty_ffmpeg INTERFACE "ffmpeg/include")
target_link_libraries(3rdparty_ffmpeg
INTERFACE
@@ -412,11 +416,25 @@ endif()
# LLVM
include(llvm.cmake)
# WOLFSSL
add_subdirectory(wolfssl EXCLUDE_FROM_ALL)
# CURL
if(USE_SYSTEM_CURL)
message("-- RPCS3: using shared libcurl")
find_package(CURL REQUIRED)
add_library(libcurl INTERFACE)
target_link_libraries(libcurl INTERFACE CURL::libcurl)
else()
message("-- RPCS3: building libcurl + wolfssl submodules")
add_subdirectory(curl EXCLUDE_FROM_ALL)
endif()
# add nice ALIAS targets for ease of use
add_library(3rdparty::libusb ALIAS usb-1.0-static)
add_library(3rdparty::zlib ALIAS 3rdparty_zlib)
add_library(3rdparty::7z ALIAS 3rdparty_7z)
add_library(3rdparty::flatbuffers ALIAS 3rdparty_flatbuffers)
add_library(3rdparty::pugixml ALIAS pugixml)
add_library(3rdparty::yaml-cpp ALIAS yaml-cpp)
add_library(3rdparty::xxhash ALIAS xxhash)
@@ -435,3 +453,5 @@ add_library(3rdparty::vulkan ALIAS ${VULKAN_TARGET})
add_library(3rdparty::openal ALIAS 3rdparty_openal)
add_library(3rdparty::ffmpeg ALIAS 3rdparty_ffmpeg)
add_library(3rdparty::glew ALIAS 3rdparty_glew)
add_library(3rdparty::wolfssl ALIAS wolfssl-3-static)
add_library(3rdparty::libcurl ALIAS libcurl)
+383 -77
View File
@@ -1,12 +1,12 @@
#ifndef __glext_h_
#define __glext_h_ 1
#ifndef __gl_glext_h_
#define __gl_glext_h_ 1
#ifdef __cplusplus
extern "C" {
#endif
/*
** Copyright (c) 2013-2017 The Khronos Group Inc.
** Copyright (c) 2013-2018 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
@@ -51,7 +51,9 @@ extern "C" {
#define GLAPI extern
#endif
#define GL_GLEXT_VERSION 20180114
#define GL_GLEXT_VERSION 20200423
#include "khrplatform.h"
/* Generated C header for:
* API: gl
@@ -464,9 +466,8 @@ GLAPI void APIENTRY glBlendEquation (GLenum mode);
#ifndef GL_VERSION_1_5
#define GL_VERSION_1_5 1
#include <stddef.h>
typedef ptrdiff_t GLsizeiptr;
typedef ptrdiff_t GLintptr;
typedef khronos_ssize_t GLsizeiptr;
typedef khronos_intptr_t GLintptr;
#define GL_BUFFER_SIZE 0x8764
#define GL_BUFFER_USAGE 0x8765
#define GL_QUERY_COUNTER_BITS 0x8864
@@ -879,7 +880,7 @@ GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboole
#ifndef GL_VERSION_3_0
#define GL_VERSION_3_0 1
typedef unsigned short GLhalf;
typedef khronos_uint16_t GLhalf;
#define GL_COMPARE_REF_TO_TEXTURE 0x884E
#define GL_CLIP_DISTANCE0 0x3000
#define GL_CLIP_DISTANCE1 0x3001
@@ -1383,45 +1384,8 @@ GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIn
#ifndef GL_VERSION_3_2
#define GL_VERSION_3_2 1
typedef struct __GLsync *GLsync;
#ifndef GLEXT_64_TYPES_DEFINED
/* This code block is duplicated in glxext.h, so must be protected */
#define GLEXT_64_TYPES_DEFINED
/* Define int32_t, int64_t, and uint64_t types for UST/MSC */
/* (as used in the GL_EXT_timer_query extension). */
#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L
#include <inttypes.h>
#elif defined(__sun__) || defined(__digital__)
#include <inttypes.h>
#if defined(__STDC__)
#if defined(__arch64__) || defined(_LP64)
typedef long int int64_t;
typedef unsigned long int uint64_t;
#else
typedef long long int int64_t;
typedef unsigned long long int uint64_t;
#endif /* __arch64__ */
#endif /* __STDC__ */
#elif defined( __VMS ) || defined(__sgi)
#include <inttypes.h>
#elif defined(__SCO__) || defined(__USLC__)
#include <stdint.h>
#elif defined(__UNIXOS2__) || defined(__SOL64__)
typedef long int int32_t;
typedef long long int int64_t;
typedef unsigned long long int uint64_t;
#elif defined(_WIN32) && defined(__GNUC__)
#include <stdint.h>
#elif defined(_WIN32)
typedef __int32 int32_t;
typedef __int64 int64_t;
typedef unsigned __int64 uint64_t;
#else
/* Fallback if nothing above works */
#include <inttypes.h>
#endif
#endif
typedef uint64_t GLuint64;
typedef int64_t GLint64;
typedef khronos_uint64_t GLuint64;
typedef khronos_int64_t GLint64;
#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001
#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002
#define GL_LINES_ADJACENCY 0x000A
@@ -1497,7 +1461,7 @@ typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync);
typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data);
typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data);
typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params);
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1517,7 +1481,7 @@ GLAPI void APIENTRY glDeleteSync (GLsync sync);
GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data);
GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data);
GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params);
GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1773,8 +1737,8 @@ typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location,
typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name);
typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices);
typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -1820,8 +1784,8 @@ GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *pa
GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name);
GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices);
GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params);
GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -2175,7 +2139,7 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data)
typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers);
@@ -2188,7 +2152,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m
GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params);
GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers);
@@ -2469,7 +2433,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect);
typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level);
typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2481,7 +2445,7 @@ typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum
typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2513,7 +2477,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect);
GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param);
GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params);
GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params);
GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level);
GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2525,7 +2489,7 @@ GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const
GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params);
GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2936,7 +2900,7 @@ GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLflo
#ifndef GL_ARB_bindless_texture
#define GL_ARB_bindless_texture 1
typedef uint64_t GLuint64EXT;
typedef khronos_uint64_t GLuint64EXT;
#define GL_UNSIGNED_INT64_ARB 0x140F
typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture);
typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler);
@@ -3496,7 +3460,7 @@ GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, G
#ifndef GL_ARB_half_float_pixel
#define GL_ARB_half_float_pixel 1
typedef unsigned short GLhalfARB;
typedef khronos_uint16_t GLhalfARB;
#define GL_HALF_FLOAT_ARB 0x140B
#endif /* GL_ARB_half_float_pixel */
@@ -3666,6 +3630,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor);
#ifndef GL_ARB_internalformat_query2
#define GL_ARB_internalformat_query2 1
#define GL_SRGB_DECODE_ARB 0x8299
#define GL_VIEW_CLASS_EAC_R11 0x9383
#define GL_VIEW_CLASS_EAC_RG11 0x9384
#define GL_VIEW_CLASS_ETC2_RGB 0x9385
#define GL_VIEW_CLASS_ETC2_RGBA 0x9386
#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387
#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388
#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389
#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A
#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B
#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C
#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D
#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E
#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F
#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390
#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391
#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392
#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393
#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394
#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395
#endif /* GL_ARB_internalformat_query2 */
#ifndef GL_ARB_invalidate_subdata
@@ -4713,8 +4696,8 @@ GLAPI void APIENTRY glVertexBlendARB (GLint count);
#ifndef GL_ARB_vertex_buffer_object
#define GL_ARB_vertex_buffer_object 1
typedef ptrdiff_t GLsizeiptrARB;
typedef ptrdiff_t GLintptrARB;
typedef khronos_ssize_t GLsizeiptrARB;
typedef khronos_intptr_t GLintptrARB;
#define GL_BUFFER_SIZE_ARB 0x8764
#define GL_BUFFER_USAGE_ARB 0x8765
#define GL_ARRAY_BUFFER_ARB 0x8892
@@ -4909,6 +4892,12 @@ GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcha
#ifndef GL_ARB_viewport_array
#define GL_ARB_viewport_array 1
typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYDVNVPROC) (GLuint first, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDDNVPROC) (GLuint index, GLdouble n, GLdouble f);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDepthRangeArraydvNV (GLuint first, GLsizei count, const GLdouble *v);
GLAPI void APIENTRY glDepthRangeIndexeddNV (GLuint index, GLdouble n, GLdouble f);
#endif
#endif /* GL_ARB_viewport_array */
#ifndef GL_ARB_window_pos
@@ -5009,6 +4998,22 @@ GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count);
#define GL_CONTEXT_ROBUST_ACCESS 0x90F3
#endif /* GL_KHR_robustness */
#ifndef GL_KHR_shader_subgroup
#define GL_KHR_shader_subgroup 1
#define GL_SUBGROUP_SIZE_KHR 0x9532
#define GL_SUBGROUP_SUPPORTED_STAGES_KHR 0x9533
#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534
#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR 0x9535
#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001
#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR 0x00000002
#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004
#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008
#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010
#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020
#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040
#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR 0x00000080
#endif /* GL_KHR_shader_subgroup */
#ifndef GL_KHR_texture_compression_astc_hdr
#define GL_KHR_texture_compression_astc_hdr 1
#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0
@@ -5115,7 +5120,7 @@ GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords);
#ifndef GL_OES_fixed_point
#define GL_OES_fixed_point 1
typedef GLint GLfixed;
typedef khronos_int32_t GLfixed;
#define GL_FIXED_OES 0x140C
typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref);
typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha);
@@ -5411,12 +5416,12 @@ typedef void (APIENTRY *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severi
typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam);
typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam);
GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
#endif
#endif /* GL_AMD_debug_output */
@@ -5440,6 +5445,22 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG
#endif
#endif /* GL_AMD_draw_buffers_blend */
#ifndef GL_AMD_framebuffer_multisample_advanced
#define GL_AMD_framebuffer_multisample_advanced 1
#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2
#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3
#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4
#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5
#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6
#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7
typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
#endif
#endif /* GL_AMD_framebuffer_multisample_advanced */
#ifndef GL_AMD_framebuffer_sample_positions
#define GL_AMD_framebuffer_sample_positions 1
#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F
@@ -5485,7 +5506,7 @@ GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLe
#ifndef GL_AMD_gpu_shader_int64
#define GL_AMD_gpu_shader_int64 1
typedef int64_t GLint64EXT;
typedef khronos_int64_t GLint64EXT;
#define GL_INT64_NV 0x140E
#define GL_UNSIGNED_INT64_NV 0x140F
#define GL_INT8_NV 0x8FE0
@@ -5704,6 +5725,10 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf
#define GL_AMD_shader_explicit_vertex_parameter 1
#endif /* GL_AMD_shader_explicit_vertex_parameter */
#ifndef GL_AMD_shader_gpu_shader_half_float_fetch
#define GL_AMD_shader_gpu_shader_half_float_fetch 1
#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */
#ifndef GL_AMD_shader_image_load_store_lod
#define GL_AMD_shader_image_load_store_lod 1
#endif /* GL_AMD_shader_image_load_store_lod */
@@ -6451,6 +6476,21 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param);
#define GL_422_REV_AVERAGE_EXT 0x80CF
#endif /* GL_EXT_422_pixels */
#ifndef GL_EXT_EGL_image_storage
#define GL_EXT_EGL_image_storage 1
typedef void *GLeglImageOES;
typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list);
typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list);
GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
#endif
#endif /* GL_EXT_EGL_image_storage */
#ifndef GL_EXT_EGL_sync
#define GL_EXT_EGL_sync 1
#endif /* GL_EXT_EGL_sync */
#ifndef GL_EXT_abgr
#define GL_EXT_abgr 1
#define GL_ABGR_EXT 0x8000
@@ -7780,6 +7820,18 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern);
#endif
#endif /* GL_EXT_multisample */
#ifndef GL_EXT_multiview_tessellation_geometry_shader
#define GL_EXT_multiview_tessellation_geometry_shader 1
#endif /* GL_EXT_multiview_tessellation_geometry_shader */
#ifndef GL_EXT_multiview_texture_multisample
#define GL_EXT_multiview_texture_multisample 1
#endif /* GL_EXT_multiview_texture_multisample */
#ifndef GL_EXT_multiview_timer_query
#define GL_EXT_multiview_timer_query 1
#endif /* GL_EXT_multiview_timer_query */
#ifndef GL_EXT_packed_depth_stencil
#define GL_EXT_packed_depth_stencil 1
#define GL_DEPTH_STENCIL_EXT 0x84F9
@@ -8049,6 +8101,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin
#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA
#endif /* GL_EXT_separate_specular_color */
#ifndef GL_EXT_shader_framebuffer_fetch
#define GL_EXT_shader_framebuffer_fetch 1
#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52
#endif /* GL_EXT_shader_framebuffer_fetch */
#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent
#define GL_EXT_shader_framebuffer_fetch_non_coherent 1
typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void);
#endif
#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */
#ifndef GL_EXT_shader_image_load_formatted
#define GL_EXT_shader_image_load_formatted 1
#endif /* GL_EXT_shader_image_load_formatted */
@@ -8485,6 +8550,11 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F
#endif /* GL_EXT_texture_sRGB */
#ifndef GL_EXT_texture_sRGB_R8
#define GL_EXT_texture_sRGB_R8 1
#define GL_SR8_EXT 0x8FBD
#endif /* GL_EXT_texture_sRGB_R8 */
#ifndef GL_EXT_texture_sRGB_decode
#define GL_EXT_texture_sRGB_decode 1
#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48
@@ -8492,6 +8562,10 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
#define GL_SKIP_DECODE_EXT 0x8A4A
#endif /* GL_EXT_texture_sRGB_decode */
#ifndef GL_EXT_texture_shadow_lod
#define GL_EXT_texture_shadow_lod 1
#endif /* GL_EXT_texture_shadow_lod */
#ifndef GL_EXT_texture_shared_exponent
#define GL_EXT_texture_shared_exponent 1
#define GL_RGB9_E5_EXT 0x8C3D
@@ -9098,6 +9172,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG
#define GL_INTERLACE_READ_INGR 0x8568
#endif /* GL_INGR_interlace_read */
#ifndef GL_INTEL_blackhole_render
#define GL_INTEL_blackhole_render 1
#define GL_BLACKHOLE_RENDER_INTEL 0x83FC
#endif /* GL_INTEL_blackhole_render */
#ifndef GL_INTEL_conservative_rasterization
#define GL_INTEL_conservative_rasterization 1
#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE
@@ -9206,6 +9285,27 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen
#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E
#endif /* GL_MESAX_texture_stack */
#ifndef GL_MESA_framebuffer_flip_x
#define GL_MESA_framebuffer_flip_x 1
#define GL_FRAMEBUFFER_FLIP_X_MESA 0x8BBC
#endif /* GL_MESA_framebuffer_flip_x */
#ifndef GL_MESA_framebuffer_flip_y
#define GL_MESA_framebuffer_flip_y 1
#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB
typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param);
GLAPI void APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params);
#endif
#endif /* GL_MESA_framebuffer_flip_y */
#ifndef GL_MESA_framebuffer_swap_xy
#define GL_MESA_framebuffer_swap_xy 1
#define GL_FRAMEBUFFER_SWAP_XY_MESA 0x8BBD
#endif /* GL_MESA_framebuffer_swap_xy */
#ifndef GL_MESA_pack_invert
#define GL_MESA_pack_invert 1
#define GL_PACK_INVERT_MESA 0x8758
@@ -9319,6 +9419,25 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void);
#define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B
#endif /* GL_NVX_gpu_memory_info */
#ifndef GL_NVX_gpu_multicast2
#define GL_NVX_gpu_multicast2 1
#define GL_UPLOAD_GPU_MASK_NVX 0x954A
typedef void (APIENTRYP PFNGLUPLOADGPUMASKNVXPROC) (GLbitfield mask);
typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTPOSITIONWSCALENVXPROC) (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
typedef void (APIENTRYP PFNGLMULTICASTSCISSORARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
typedef GLuint (APIENTRYP PFNGLASYNCCOPYBUFFERSUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
typedef GLuint (APIENTRYP PFNGLASYNCCOPYIMAGESUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glUploadGpuMaskNVX (GLbitfield mask);
GLAPI void APIENTRY glMulticastViewportArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glMulticastViewportPositionWScaleNVX (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
GLAPI void APIENTRY glMulticastScissorArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
GLAPI GLuint APIENTRY glAsyncCopyBufferSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
GLAPI GLuint APIENTRY glAsyncCopyImageSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
#endif
#endif /* GL_NVX_gpu_multicast2 */
#ifndef GL_NVX_linked_gpu_multicast
#define GL_NVX_linked_gpu_multicast 1
#define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800
@@ -9333,6 +9452,20 @@ GLAPI void APIENTRY glLGPUInterlockNVX (void);
#endif
#endif /* GL_NVX_linked_gpu_multicast */
#ifndef GL_NVX_progress_fence
#define GL_NVX_progress_fence 1
typedef GLuint (APIENTRYP PFNGLCREATEPROGRESSFENCENVXPROC) (void);
typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREUI64NVXPROC) (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
typedef void (APIENTRYP PFNGLWAITSEMAPHOREUI64NVXPROC) (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
typedef void (APIENTRYP PFNGLCLIENTWAITSEMAPHOREUI64NVXPROC) (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLuint APIENTRY glCreateProgressFenceNVX (void);
GLAPI void APIENTRY glSignalSemaphoreui64NVX (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
GLAPI void APIENTRY glWaitSemaphoreui64NVX (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
GLAPI void APIENTRY glClientWaitSemaphoreui64NVX (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
#endif
#endif /* GL_NVX_progress_fence */
#ifndef GL_NV_alpha_to_coverage_dither_control
#define GL_NV_alpha_to_coverage_dither_control 1
#define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D
@@ -9545,6 +9678,10 @@ GLAPI void APIENTRY glCallCommandListNV (GLuint list);
#define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC
#endif /* GL_NV_compute_program5 */
#ifndef GL_NV_compute_shader_derivatives
#define GL_NV_compute_shader_derivatives 1
#endif /* GL_NV_compute_shader_derivatives */
#ifndef GL_NV_conditional_render
#define GL_NV_conditional_render 1
#define GL_QUERY_WAIT_NV 0x8E13
@@ -9843,6 +9980,10 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
#define GL_NV_fragment_program_option 1
#endif /* GL_NV_fragment_program_option */
#ifndef GL_NV_fragment_shader_barycentric
#define GL_NV_fragment_shader_barycentric 1
#endif /* GL_NV_fragment_shader_barycentric */
#ifndef GL_NV_fragment_shader_interlock
#define GL_NV_fragment_shader_interlock 1
#endif /* GL_NV_fragment_shader_interlock */
@@ -9858,11 +9999,11 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
#define GL_COVERAGE_MODULATION_NV 0x9332
#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v);
typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v);
typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v);
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v);
GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v);
GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v);
GLAPI void APIENTRY glCoverageModulationNV (GLenum components);
#endif
#endif /* GL_NV_framebuffer_mixed_samples */
@@ -10115,9 +10256,9 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN
#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372
#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373
#define GL_CONFORMANT_NV 0x9374
typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params);
GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
#endif
#endif /* GL_NV_internalformat_sample_query */
@@ -10127,6 +10268,96 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna
#define GL_MAX_SPOT_EXPONENT_NV 0x8505
#endif /* GL_NV_light_max_exponent */
#ifndef GL_NV_memory_attachment
#define GL_NV_memory_attachment 1
#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4
#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5
#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6
#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7
#define GL_MEMORY_ATTACHABLE_NV 0x95A8
#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9
#define GL_DETACHED_TEXTURES_NV 0x95AA
#define GL_DETACHED_BUFFERS_NV 0x95AB
#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC
#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD
typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname);
typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname);
GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset);
#endif
#endif /* GL_NV_memory_attachment */
#ifndef GL_NV_mesh_shader
#define GL_NV_mesh_shader 1
#define GL_MESH_SHADER_NV 0x9559
#define GL_TASK_SHADER_NV 0x955A
#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60
#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61
#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62
#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63
#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64
#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65
#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66
#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67
#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68
#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69
#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A
#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B
#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C
#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D
#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E
#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F
#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2
#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3
#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536
#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537
#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538
#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539
#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A
#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D
#define GL_MAX_MESH_VIEWS_NV 0x9557
#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF
#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543
#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B
#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C
#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E
#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F
#define GL_MESH_VERTICES_OUT_NV 0x9579
#define GL_MESH_PRIMITIVES_OUT_NV 0x957A
#define GL_MESH_OUTPUT_TYPE_NV 0x957B
#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C
#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D
#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0
#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1
#define GL_MESH_SHADER_BIT_NV 0x00000040
#define GL_TASK_SHADER_BIT_NV 0x00000080
#define GL_MESH_SUBROUTINE_NV 0x957C
#define GL_TASK_SUBROUTINE_NV 0x957D
#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E
#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F
#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E
#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F
typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count);
typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect);
typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride);
typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count);
GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect);
GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride);
GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
#endif
#endif /* GL_NV_mesh_shader */
#ifndef GL_NV_multisample_coverage
#define GL_NV_multisample_coverage 1
#endif /* GL_NV_multisample_coverage */
@@ -10408,7 +10639,7 @@ typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, co
typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode);
@@ -10473,7 +10704,7 @@ GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fo
GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params);
GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glPathFogGenNV (GLenum genMode);
@@ -10562,9 +10793,9 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index);
#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545
#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546
#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547
typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer);
typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer);
GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
#endif
#endif /* GL_NV_query_resource */
@@ -10672,6 +10903,11 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname,
#endif
#endif /* GL_NV_register_combiners2 */
#ifndef GL_NV_representative_fragment_test
#define GL_NV_representative_fragment_test 1
#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F
#endif /* GL_NV_representative_fragment_test */
#ifndef GL_NV_robustness_video_memory_purge
#define GL_NV_robustness_video_memory_purge 1
#define GL_PURGED_CONTEXT_RESET_NV 0x92BB
@@ -10701,6 +10937,18 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void);
#define GL_NV_sample_mask_override_coverage 1
#endif /* GL_NV_sample_mask_override_coverage */
#ifndef GL_NV_scissor_exclusive
#define GL_NV_scissor_exclusive 1
#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555
#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556
typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height);
GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v);
#endif
#endif /* GL_NV_scissor_exclusive */
#ifndef GL_NV_shader_atomic_counters
#define GL_NV_shader_atomic_counters 1
#endif /* GL_NV_shader_atomic_counters */
@@ -10765,6 +11013,15 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
#define GL_NV_shader_storage_buffer_object 1
#endif /* GL_NV_shader_storage_buffer_object */
#ifndef GL_NV_shader_subgroup_partitioned
#define GL_NV_shader_subgroup_partitioned 1
#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100
#endif /* GL_NV_shader_subgroup_partitioned */
#ifndef GL_NV_shader_texture_footprint
#define GL_NV_shader_texture_footprint 1
#endif /* GL_NV_shader_texture_footprint */
#ifndef GL_NV_shader_thread_group
#define GL_NV_shader_thread_group 1
#define GL_WARP_SIZE_NV 0x9339
@@ -10776,6 +11033,47 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
#define GL_NV_shader_thread_shuffle 1
#endif /* GL_NV_shader_thread_shuffle */
#ifndef GL_NV_shading_rate_image
#define GL_NV_shading_rate_image 1
#define GL_SHADING_RATE_IMAGE_NV 0x9563
#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564
#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565
#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566
#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567
#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568
#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569
#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A
#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B
#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C
#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D
#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E
#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F
#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B
#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C
#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D
#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E
#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F
#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE
#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF
#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0
typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture);
typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate);
typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location);
typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize);
typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order);
typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture);
GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate);
GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location);
GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize);
GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order);
GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations);
#endif
#endif /* GL_NV_shading_rate_image */
#ifndef GL_NV_stereo_view_rendering
#define GL_NV_stereo_view_rendering 1
#endif /* GL_NV_stereo_view_rendering */
@@ -11068,7 +11366,7 @@ typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const
typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface);
typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface);
typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access);
typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
@@ -11079,13 +11377,21 @@ GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSu
GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface);
GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface);
GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values);
GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access);
GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
#endif
#endif /* GL_NV_vdpau_interop */
#ifndef GL_NV_vdpau_interop2
#define GL_NV_vdpau_interop2 1
typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
#endif
#endif /* GL_NV_vdpau_interop2 */
#ifndef GL_NV_vertex_array_range
#define GL_NV_vertex_array_range 1
#define GL_VERTEX_ARRAY_RANGE_NV 0x851D
+290
View File
@@ -0,0 +1,290 @@
#ifndef __khrplatform_h_
#define __khrplatform_h_
/*
** Copyright (c) 2008-2018 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
** "Materials"), to deal in the Materials without restriction, including
** without limitation the rights to use, copy, modify, merge, publish,
** distribute, sublicense, and/or sell copies of the Materials, and to
** permit persons to whom the Materials are furnished to do so, subject to
** the following conditions:
**
** The above copyright notice and this permission notice shall be included
** in all copies or substantial portions of the Materials.
**
** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY
** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
*/
/* Khronos platform-specific types and definitions.
*
* The master copy of khrplatform.h is maintained in the Khronos EGL
* Registry repository at https://github.com/KhronosGroup/EGL-Registry
* The last semantic modification to khrplatform.h was at commit ID:
* 67a3e0864c2d75ea5287b9f3d2eb74a745936692
*
* Adopters may modify this file to suit their platform. Adopters are
* encouraged to submit platform specific modifications to the Khronos
* group so that they can be included in future versions of this file.
* Please submit changes by filing pull requests or issues on
* the EGL Registry repository linked above.
*
*
* See the Implementer's Guidelines for information about where this file
* should be located on your system and for more details of its use:
* http://www.khronos.org/registry/implementers_guide.pdf
*
* This file should be included as
* #include <KHR/khrplatform.h>
* by Khronos client API header files that use its types and defines.
*
* The types in khrplatform.h should only be used to define API-specific types.
*
* Types defined in khrplatform.h:
* khronos_int8_t signed 8 bit
* khronos_uint8_t unsigned 8 bit
* khronos_int16_t signed 16 bit
* khronos_uint16_t unsigned 16 bit
* khronos_int32_t signed 32 bit
* khronos_uint32_t unsigned 32 bit
* khronos_int64_t signed 64 bit
* khronos_uint64_t unsigned 64 bit
* khronos_intptr_t signed same number of bits as a pointer
* khronos_uintptr_t unsigned same number of bits as a pointer
* khronos_ssize_t signed size
* khronos_usize_t unsigned size
* khronos_float_t signed 32 bit floating point
* khronos_time_ns_t unsigned 64 bit time in nanoseconds
* khronos_utime_nanoseconds_t unsigned time interval or absolute time in
* nanoseconds
* khronos_stime_nanoseconds_t signed time interval in nanoseconds
* khronos_boolean_enum_t enumerated boolean type. This should
* only be used as a base type when a client API's boolean type is
* an enum. Client APIs which use an integer or other type for
* booleans cannot use this as the base type for their boolean.
*
* Tokens defined in khrplatform.h:
*
* KHRONOS_FALSE, KHRONOS_TRUE Enumerated boolean false/true values.
*
* KHRONOS_SUPPORT_INT64 is 1 if 64 bit integers are supported; otherwise 0.
* KHRONOS_SUPPORT_FLOAT is 1 if floats are supported; otherwise 0.
*
* Calling convention macros defined in this file:
* KHRONOS_APICALL
* KHRONOS_APIENTRY
* KHRONOS_APIATTRIBUTES
*
* These may be used in function prototypes as:
*
* KHRONOS_APICALL void KHRONOS_APIENTRY funcname(
* int arg1,
* int arg2) KHRONOS_APIATTRIBUTES;
*/
#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC)
# define KHRONOS_STATIC 1
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APICALL
*-------------------------------------------------------------------------
* This precedes the return type of the function in the function prototype.
*/
#if defined(KHRONOS_STATIC)
/* If the preprocessor constant KHRONOS_STATIC is defined, make the
* header compatible with static linking. */
# define KHRONOS_APICALL
#elif defined(_WIN32)
# define KHRONOS_APICALL __declspec(dllimport)
#elif defined (__SYMBIAN32__)
# define KHRONOS_APICALL IMPORT_C
#elif defined(__ANDROID__)
# define KHRONOS_APICALL __attribute__((visibility("default")))
#else
# define KHRONOS_APICALL
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APIENTRY
*-------------------------------------------------------------------------
* This follows the return type of the function and precedes the function
* name in the function prototype.
*/
#if defined(_WIN32) && !defined(_WIN32_WCE) && !defined(KHRONOS_STATIC)
/* Win32 but not WinCE */
# define KHRONOS_APIENTRY __stdcall
#else
# define KHRONOS_APIENTRY
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APIATTRIBUTES
*-------------------------------------------------------------------------
* This follows the closing parenthesis of the function prototype arguments.
*/
#if defined (__ARMCC_2__)
#define KHRONOS_APIATTRIBUTES __softfp
#else
#define KHRONOS_APIATTRIBUTES
#endif
/*-------------------------------------------------------------------------
* basic type definitions
*-----------------------------------------------------------------------*/
#if (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || defined(__GNUC__) || defined(__SCO__) || defined(__USLC__)
/*
* Using <stdint.h>
*/
#include <stdint.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(__VMS ) || defined(__sgi)
/*
* Using <inttypes.h>
*/
#include <inttypes.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(_WIN32) && !defined(__SCITECH_SNAP__)
/*
* Win32
*/
typedef __int32 khronos_int32_t;
typedef unsigned __int32 khronos_uint32_t;
typedef __int64 khronos_int64_t;
typedef unsigned __int64 khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(__sun__) || defined(__digital__)
/*
* Sun or Digital
*/
typedef int khronos_int32_t;
typedef unsigned int khronos_uint32_t;
#if defined(__arch64__) || defined(_LP64)
typedef long int khronos_int64_t;
typedef unsigned long int khronos_uint64_t;
#else
typedef long long int khronos_int64_t;
typedef unsigned long long int khronos_uint64_t;
#endif /* __arch64__ */
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif 0
/*
* Hypothetical platform with no float or int64 support
*/
typedef int khronos_int32_t;
typedef unsigned int khronos_uint32_t;
#define KHRONOS_SUPPORT_INT64 0
#define KHRONOS_SUPPORT_FLOAT 0
#else
/*
* Generic fallback
*/
#include <stdint.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#endif
/*
* Types that are (so far) the same on all platforms
*/
typedef signed char khronos_int8_t;
typedef unsigned char khronos_uint8_t;
typedef signed short int khronos_int16_t;
typedef unsigned short int khronos_uint16_t;
/*
* Types that differ between LLP64 and LP64 architectures - in LLP64,
* pointers are 64 bits, but 'long' is still 32 bits. Win64 appears
* to be the only LLP64 architecture in current use.
*/
#ifdef _WIN64
typedef signed long long int khronos_intptr_t;
typedef unsigned long long int khronos_uintptr_t;
typedef signed long long int khronos_ssize_t;
typedef unsigned long long int khronos_usize_t;
#else
typedef signed long int khronos_intptr_t;
typedef unsigned long int khronos_uintptr_t;
typedef signed long int khronos_ssize_t;
typedef unsigned long int khronos_usize_t;
#endif
#if KHRONOS_SUPPORT_FLOAT
/*
* Float type
*/
typedef float khronos_float_t;
#endif
#if KHRONOS_SUPPORT_INT64
/* Time types
*
* These types can be used to represent a time interval in nanoseconds or
* an absolute Unadjusted System Time. Unadjusted System Time is the number
* of nanoseconds since some arbitrary system event (e.g. since the last
* time the system booted). The Unadjusted System Time is an unsigned
* 64 bit value that wraps back to 0 every 584 years. Time intervals
* may be either signed or unsigned.
*/
typedef khronos_uint64_t khronos_utime_nanoseconds_t;
typedef khronos_int64_t khronos_stime_nanoseconds_t;
#endif
/*
* Dummy value used to pad enum types to 32 bits.
*/
#ifndef KHRONOS_MAX_ENUM
#define KHRONOS_MAX_ENUM 0x7FFFFFFF
#endif
/*
* Enumerated boolean type
*
* Values other than zero should be considered to be true. Therefore
* comparisons should not be made against KHRONOS_TRUE.
*/
typedef enum {
KHRONOS_FALSE = 0,
KHRONOS_TRUE = 1,
KHRONOS_BOOLEAN_ENUM_FORCE_SIZE = KHRONOS_MAX_ENUM
} khronos_boolean_enum_t;
#endif /* __khrplatform_h_ */
+2 -2
View File
@@ -31,9 +31,9 @@ extern "C" {
#define ALC_VERSION_0_1 1
/** Opaque device handle */
typedef struct ALCdevice_struct ALCdevice;
typedef struct ALCdevice ALCdevice;
/** Opaque context handle */
typedef struct ALCcontext_struct ALCcontext;
typedef struct ALCcontext ALCcontext;
/** 8-bit boolean */
typedef char ALCboolean;
+21
View File
@@ -509,6 +509,27 @@ ALC_API void ALC_APIENTRY alcGetInteger64vSOFT(ALCdevice *device, ALCenum pname,
#endif
#endif
#ifndef AL_SOFT_direct_channels_remix
#define AL_SOFT_direct_channels_remix 1
#define AL_DROP_UNMATCHED_SOFT 0x0001
#define AL_REMIX_UNMATCHED_SOFT 0x0002
#endif
#ifndef AL_SOFT_bformat_ex
#define AL_SOFT_bformat_ex 1
#define AL_AMBISONIC_LAYOUT_SOFT 0x1997
#define AL_AMBISONIC_SCALING_SOFT 0x1998
/* Ambisonic layouts */
#define AL_FUMA_SOFT 0x0000
#define AL_ACN_SOFT 0x0001
/* Ambisonic scalings (normalization) */
/*#define AL_FUMA_SOFT*/
#define AL_SN3D_SOFT 0x0001
#define AL_N3D_SOFT 0x0002
#endif
#ifdef __cplusplus
}
#endif
+1
View File
@@ -1,6 +1,7 @@
#ifndef AL_EFX_H
#define AL_EFX_H
#include <float.h>
#include "alc.h"
#include "al.h"
Binary file not shown.
@@ -7,11 +7,31 @@
*
**************************************************************************/
#ifdef _MSC_VER
#pragma once
#endif
#ifndef __XAUDIO2_INCLUDED__
#define __XAUDIO2_INCLUDED__
#include <sdkddkver.h>
// Current name of the DLL shipped in the same SDK as this header.
// The name reflects the current version
#define XAUDIO2_DLL_A "xaudio2redist.dll"
#define XAUDIO2_DLL_W L"xaudio2redist.dll"
#define XAUDIO2D_DLL_A "xaudio2redist.dll"
#define XAUDIO2D_DLL_W L"xaudio2redist.dll"
#ifdef UNICODE
#define XAUDIO2_DLL XAUDIO2_DLL_W
#define XAUDIO2D_DLL XAUDIO2D_DLL_W
#else
#define XAUDIO2_DLL XAUDIO2_DLL_A
#define XAUDIO2D_DLL XAUDIO2D_DLL_A
#endif
/**************************************************************************
*
* XAudio2 COM object class and interface IDs.
@@ -20,8 +40,19 @@
#include <basetyps.h>
// XAudio 2.8
interface __declspec(uuid("60d8dac8-5aa1-4e8e-b597-2f5e2883d484")) IXAudio2;
#ifdef __cplusplus
// XAudio 2.9
interface __declspec(uuid("2B02E3CF-2E0B-4ec3-BE45-1B2A3FE7210D")) IXAudio2;
interface __declspec(uuid("84ac29bb-d619-44d2-b197-e4acf7df3ed6")) IXAudio2Extension;
EXTERN_C const GUID DECLSPEC_SELECTANY IID_IXAudio2Extension = __uuidof(IXAudio2Extension);
EXTERN_C const GUID DECLSPEC_SELECTANY IID_IXAudio2 = __uuidof(IXAudio2);
#else // #ifdef __cplusplus
// Compiling with C for Windows 10 and later
DEFINE_GUID(IID_IXAudio2, 0x2B02E3CF, 0x2E0B, 0x4ec3, 0xBE, 0x45, 0x1B, 0x2A, 0x3F, 0xE7, 0x21, 0x0D);
DEFINE_GUID(IID_IXAudio2Extension, 0x84ac29bb, 0xd619, 0x44d2, 0xb1, 0x97, 0xe4, 0xac, 0xf7, 0xdf, 0x3e, 0xd6);
#endif // #ifdef __cplusplus
// Ignore the rest of this header if only the GUID definitions were requested
#ifndef GUID_DEFS_ONLY
@@ -31,6 +62,31 @@ interface __declspec(uuid("60d8dac8-5aa1-4e8e-b597-2f5e2883d484")) IXAudio2;
#include <mmreg.h> // Basic data types and constants for audio work
#include <audiosessiontypes.h> // For AUDIO_STREAM_CATEGORY
// The Windows 7 version of audiosessiontypes.h does not define AUDIO_STREAM_CATEGORY, so if we are targeting
// Windows 7 we might have to define it here, depending on which SDK is used.
#if _WIN32_WINNT < _WIN32_WINNT_WIN8
// If we are compiling for Windows 7, we might be using the Windows 7 Platform SDK, which does not have AUDIO_STREAM_CATEGORY.
// But we might be using a newer SDK (such as the Win8 Platform SDK), which has AUDIO_STREAM_CATEGORY.
// Determine if we are using the Windows 7 Platform SDK by checking if WAVE_FORMAT_WM9_SPECTRUM_ANALYZER is defined.
#ifndef WAVE_FORMAT_WM9_SPECTRUM_ANALYZER
typedef enum _AUDIO_STREAM_CATEGORY
{
AudioCategory_Other = 0,
AudioCategory_ForegroundOnlyMedia = 1,
AudioCategory_Communications = 3,
AudioCategory_Alerts = 4,
AudioCategory_SoundEffects = 5,
AudioCategory_GameEffects = 6,
AudioCategory_GameMedia = 7,
AudioCategory_GameChat = 8,
AudioCategory_Speech = 9,
AudioCategory_Movie = 10,
AudioCategory_Media = 11,
} AUDIO_STREAM_CATEGORY;
#endif /* WAVE_FORMAT_WM9_SPECTRUM_ANALYZER */
#endif /* NTDDI_VERSION < NTDDI_WIN8 */
// All structures defined in this file use tight field packing
#pragma pack(push, 1)
@@ -83,7 +139,7 @@ interface __declspec(uuid("60d8dac8-5aa1-4e8e-b597-2f5e2883d484")) IXAudio2;
#define XAUDIO2_VOICE_NOSAMPLESPLAYED 0x0100 // Used in IXAudio2SourceVoice::GetState
#define XAUDIO2_STOP_ENGINE_WHEN_IDLE 0x2000 // Used in XAudio2Create to force the engine to Stop when no source voices are Started, and Start when a voice is Started
#define XAUDIO2_1024_QUANTUM 0x8000 // Used in XAudio2Create to specify nondefault processing quantum of 21.33 ms (1024 samples at 48KHz)
#define XAUDIO2_NO_VIRTUAL_AUDIO_CLIENT 0x10000 // Used in CreateMasteringVoice to create a virtual audio client
#define XAUDIO2_NO_VIRTUAL_AUDIO_CLIENT 0x10000 // Used in CreateMasteringVoice to create a virtual audio client
// Default parameters for the built-in filter
#define XAUDIO2_DEFAULT_FILTER_TYPE LowPassFilter
@@ -99,10 +155,10 @@ interface __declspec(uuid("60d8dac8-5aa1-4e8e-b597-2f5e2883d484")) IXAudio2;
// XAudio2 error codes
#define FACILITY_XAUDIO2 0x896
#define XAUDIO2_E_INVALID_CALL 0x88960001 // An API call or one of its arguments was illegal
#define XAUDIO2_E_XMA_DECODER_ERROR 0x88960002 // The XMA hardware suffered an unrecoverable error
#define XAUDIO2_E_XAPO_CREATION_FAILED 0x88960003 // XAudio2 failed to initialize an XAPO effect
#define XAUDIO2_E_DEVICE_INVALIDATED 0x88960004 // An audio device became unusable (unplugged, etc)
#define XAUDIO2_E_INVALID_CALL ((HRESULT)0x88960001) // An API call or one of its arguments was illegal
#define XAUDIO2_E_XMA_DECODER_ERROR ((HRESULT)0x88960002) // The XMA hardware suffered an unrecoverable error
#define XAUDIO2_E_XAPO_CREATION_FAILED ((HRESULT)0x88960003) // XAudio2 failed to initialize an XAPO effect
#define XAUDIO2_E_DEVICE_INVALIDATED ((HRESULT)0x88960004) // An audio device became unusable (unplugged, etc)
/**************************************************************************
*
@@ -166,6 +222,13 @@ typedef UINT32 XAUDIO2_PROCESSOR;
#define Processor31 0x40000000
#define Processor32 0x80000000
#define XAUDIO2_ANY_PROCESSOR 0xffffffff
// This value indicates that XAudio2 will choose the default processor by itself. The actual value chosen
// may vary depending on the hardware platform.
#define XAUDIO2_USE_DEFAULT_PROCESSOR 0x00000000
// This definition is included for backwards compatibilty. New implementations should use
// XAUDIO2_USE_DEFAULT_PROCESSOR instead to let XAudio2 select the appropriate default processor for the hardware platform.
#define XAUDIO2_DEFAULT_PROCESSOR Processor1
// Returned by IXAudio2Voice::GetVoiceDetails
@@ -359,13 +422,13 @@ DECLARE_INTERFACE_(IXAudio2, IUnknown)
{
// NAME: IXAudio2::QueryInterface
// DESCRIPTION: Queries for a given COM interface on the XAudio2 object.
// Only IID_IUnknown and IID_IXAudio2 are supported.
// Only IID_IUnknown, IID_IXAudio2 and IID_IXaudio2Extension are supported.
//
// ARGUMENTS:
// riid - IID of the interface to be obtained.
// ppvInterface - Returns a pointer to the requested interface.
//
STDMETHOD(QueryInterface) (THIS_ REFIID riid, _Outptr_ void** ppvInterface) PURE;
STDMETHOD(QueryInterface) (THIS_ REFIID riid, _COM_Outptr_ void** ppvInterface) PURE;
// NAME: IXAudio2::AddRef
// DESCRIPTION: Adds a reference to the XAudio2 object.
@@ -489,6 +552,50 @@ DECLARE_INTERFACE_(IXAudio2, IUnknown)
_Reserved_ void* pReserved X2DEFAULT(NULL)) PURE;
};
// This interface extends IXAudio2 with additional functionality.
// Use IXAudio2::QueryInterface to obtain a pointer to this interface.
#undef INTERFACE
#define INTERFACE IXAudio2Extension
DECLARE_INTERFACE_(IXAudio2Extension, IUnknown)
{
// NAME: IXAudio2Extension::QueryInterface
// DESCRIPTION: Queries for a given COM interface on the XAudio2 object.
// Only IID_IUnknown, IID_IXAudio2 and IID_IXaudio2Extension are supported.
//
// ARGUMENTS:
// riid - IID of the interface to be obtained.
// ppvInterface - Returns a pointer to the requested interface.
//
STDMETHOD(QueryInterface) (THIS_ REFIID riid, _COM_Outptr_ void** ppvInterface) PURE;
// NAME: IXAudio2Extension::AddRef
// DESCRIPTION: Adds a reference to the XAudio2 object.
//
STDMETHOD_(ULONG, AddRef) (THIS) PURE;
// NAME: IXAudio2Extension::Release
// DESCRIPTION: Releases a reference to the XAudio2 object.
//
STDMETHOD_(ULONG, Release) (THIS) PURE;
// NAME: IXAudio2Extension::GetProcessingQuantum
// DESCRIPTION: Returns the processing quantum
// quantumMilliseconds = (1000.0f * quantumNumerator / quantumDenominator)
//
// ARGUMENTS:
// quantumNumerator - Quantum numerator
// quantumDenominator - Quantum denominator
//
STDMETHOD_(void, GetProcessingQuantum)(THIS_ _Out_ UINT32* quantumNumerator, _Out_range_(!= , 0) UINT32* quantumDenominator);
// NAME: IXAudio2Extension::GetProcessor
// DESCRIPTION: Returns the number of the processor used by XAudio2
//
// ARGUMENTS:
// processor - Non-zero Processor number
//
STDMETHOD_(void, GetProcessor)(THIS_ _Out_range_(!= , 0) XAUDIO2_PROCESSOR* processor);
};
/**************************************************************************
*
@@ -949,6 +1056,10 @@ DECLARE_INTERFACE(IXAudio2VoiceCallback)
#define IXAudio2_GetPerformanceData(This,pPerfData) ((This)->lpVtbl->GetPerformanceData(This,pPerfData))
#define IXAudio2_SetDebugConfiguration(This,pDebugConfiguration,pReserved) ((This)->lpVtbl->SetDebugConfiguration(This,pDebugConfiguration,pReserved))
// IXAudio2Extension
#define IXAudio2Extension_GetProcessingQuantum(This,quantumNumerator,quantumDenominator) ((This)->lpVtbl->GetProcessingQuantum(This,quantumNumerator,quantumDenominator))
#define IXAudio2Extension_GetProcessor(This,processor) ((This)->lpVtbl->GetProcessor(This,processor))
// IXAudio2Voice
#define IXAudio2Voice_GetVoiceDetails(This,pVoiceDetails) ((This)->lpVtbl->GetVoiceDetails(This,pVoiceDetails))
#define IXAudio2Voice_SetOutputVoices(This,pSendList) ((This)->lpVtbl->SetOutputVoices(This,pSendList))
@@ -1143,12 +1254,16 @@ __inline float XAudio2CutoffFrequencyToOnePoleCoefficient(float CutoffFrequency,
* will use. Note that XAudio2 supports concurrent processing on
* multiple threads, using any combination of XAUDIO2_PROCESSOR
* flags. The values are platform-specific; platform-independent
* code can use XAUDIO2_DEFAULT_PROCESSOR to use the default on
* code can use XAUDIO2_USE_DEFAULT_PROCESSOR to use the default on
* each platform.
*
**************************************************************************/
typedef HRESULT(*XAudio2Create)(_Outptr_ IXAudio2** ppXAudio2, UINT32 Flags, XAUDIO2_PROCESSOR XAudio2Processor);
// We're an xaudio2 client
#define XAUDIO2_STDAPI EXTERN_C DECLSPEC_IMPORT HRESULT STDAPICALLTYPE
XAUDIO2_STDAPI XAudio2Create(_Outptr_ IXAudio2** ppXAudio2, UINT32 Flags X2DEFAULT(0),
XAUDIO2_PROCESSOR XAudio2Processor X2DEFAULT(XAUDIO2_USE_DEFAULT_PROCESSOR));
// Undo the #pragma pack(push, 1) directive at the top of this file
#pragma pack(pop)
@@ -1156,3 +1271,4 @@ typedef HRESULT(*XAudio2Create)(_Outptr_ IXAudio2** ppXAudio2, UINT32 Flags, XAU
#endif // #ifndef GUID_DEFS_ONLY
#endif // #ifndef __XAUDIO2_INCLUDED__
Binary file not shown.
-1295
View File
File diff suppressed because it is too large Load Diff
-263
View File
@@ -1,263 +0,0 @@
/***************************************************************************
*
* Copyright (c) Microsoft Corporation. All rights reserved.
*
* File: audiodefs.h
* Content: Basic constants and data types for audio work.
*
* Remarks: This header file defines all of the audio format constants and
* structures required for XAudio2 and XACT work. Providing these
* in a single location avoids certain dependency problems in the
* legacy audio headers (mmreg.h, mmsystem.h, ksmedia.h).
*
* NOTE: Including the legacy headers after this one may cause a
* compilation error, because they define some of the same types
* defined here without preprocessor guards to avoid multiple
* definitions. If a source file needs one of the old headers,
* it must include it before including audiodefs.h.
*
***************************************************************************/
#ifndef __AUDIODEFS_INCLUDED__
#define __AUDIODEFS_INCLUDED__
#include <windef.h> // For WORD, DWORD, etc.
#pragma pack(push, 1) // Pack structures to 1-byte boundaries
/**************************************************************************
*
* WAVEFORMATEX: Base structure for many audio formats. Format-specific
* extensions can be defined for particular formats by using a non-zero
* cbSize value and adding extra fields to the end of this structure.
*
***************************************************************************/
#ifndef _WAVEFORMATEX_
#define _WAVEFORMATEX_
typedef struct tWAVEFORMATEX
{
WORD wFormatTag; // Integer identifier of the format
WORD nChannels; // Number of audio channels
DWORD nSamplesPerSec; // Audio sample rate
DWORD nAvgBytesPerSec; // Bytes per second (possibly approximate)
WORD nBlockAlign; // Size in bytes of a sample block (all channels)
WORD wBitsPerSample; // Size in bits of a single per-channel sample
WORD cbSize; // Bytes of extra data appended to this struct
} WAVEFORMATEX;
#endif
// Defining pointer types outside of the #if block to make sure they are
// defined even if mmreg.h or mmsystem.h is #included before this file
typedef WAVEFORMATEX *PWAVEFORMATEX, *NPWAVEFORMATEX, *LPWAVEFORMATEX;
typedef const WAVEFORMATEX *PCWAVEFORMATEX, *LPCWAVEFORMATEX;
/**************************************************************************
*
* WAVEFORMATEXTENSIBLE: Extended version of WAVEFORMATEX that should be
* used as a basis for all new audio formats. The format tag is replaced
* with a GUID, allowing new formats to be defined without registering a
* format tag with Microsoft. There are also new fields that can be used
* to specify the spatial positions for each channel and the bit packing
* used for wide samples (e.g. 24-bit PCM samples in 32-bit containers).
*
***************************************************************************/
#ifndef _WAVEFORMATEXTENSIBLE_
#define _WAVEFORMATEXTENSIBLE_
typedef struct
{
WAVEFORMATEX Format; // Base WAVEFORMATEX data
union
{
WORD wValidBitsPerSample; // Valid bits in each sample container
WORD wSamplesPerBlock; // Samples per block of audio data; valid
// if wBitsPerSample=0 (but rarely used).
WORD wReserved; // Zero if neither case above applies.
} Samples;
DWORD dwChannelMask; // Positions of the audio channels
GUID SubFormat; // Format identifier GUID
} WAVEFORMATEXTENSIBLE;
#endif
typedef WAVEFORMATEXTENSIBLE *PWAVEFORMATEXTENSIBLE, *LPWAVEFORMATEXTENSIBLE;
typedef const WAVEFORMATEXTENSIBLE *PCWAVEFORMATEXTENSIBLE, *LPCWAVEFORMATEXTENSIBLE;
/**************************************************************************
*
* Define the most common wave format tags used in WAVEFORMATEX formats.
*
***************************************************************************/
#ifndef WAVE_FORMAT_PCM // Pulse Code Modulation
// If WAVE_FORMAT_PCM is not defined, we need to define some legacy types
// for compatibility with the Windows mmreg.h / mmsystem.h header files.
// Old general format structure (information common to all formats)
typedef struct waveformat_tag
{
WORD wFormatTag;
WORD nChannels;
DWORD nSamplesPerSec;
DWORD nAvgBytesPerSec;
WORD nBlockAlign;
} WAVEFORMAT, *PWAVEFORMAT, NEAR *NPWAVEFORMAT, FAR *LPWAVEFORMAT;
// Specific format structure for PCM data
typedef struct pcmwaveformat_tag
{
WAVEFORMAT wf;
WORD wBitsPerSample;
} PCMWAVEFORMAT, *PPCMWAVEFORMAT, NEAR *NPPCMWAVEFORMAT, FAR *LPPCMWAVEFORMAT;
#define WAVE_FORMAT_PCM 0x0001
#endif
#ifndef WAVE_FORMAT_ADPCM // Microsoft Adaptive Differental PCM
// Replicate the Microsoft ADPCM type definitions from mmreg.h.
typedef struct adpcmcoef_tag
{
short iCoef1;
short iCoef2;
} ADPCMCOEFSET;
#pragma warning(push)
#pragma warning(disable:4200) // Disable zero-sized array warnings
typedef struct adpcmwaveformat_tag {
WAVEFORMATEX wfx;
WORD wSamplesPerBlock;
WORD wNumCoef;
ADPCMCOEFSET aCoef[]; // Always 7 coefficient pairs for MS ADPCM
} ADPCMWAVEFORMAT;
#pragma warning(pop)
#define WAVE_FORMAT_ADPCM 0x0002
#endif
// Other frequently used format tags
#ifndef WAVE_FORMAT_UNKNOWN
#define WAVE_FORMAT_UNKNOWN 0x0000 // Unknown or invalid format tag
#endif
#ifndef WAVE_FORMAT_IEEE_FLOAT
#define WAVE_FORMAT_IEEE_FLOAT 0x0003 // 32-bit floating-point
#endif
#ifndef WAVE_FORMAT_MPEGLAYER3
#define WAVE_FORMAT_MPEGLAYER3 0x0055 // ISO/MPEG Layer3
#endif
#ifndef WAVE_FORMAT_DOLBY_AC3_SPDIF
#define WAVE_FORMAT_DOLBY_AC3_SPDIF 0x0092 // Dolby Audio Codec 3 over S/PDIF
#endif
#ifndef WAVE_FORMAT_WMAUDIO2
#define WAVE_FORMAT_WMAUDIO2 0x0161 // Windows Media Audio
#endif
#ifndef WAVE_FORMAT_WMAUDIO3
#define WAVE_FORMAT_WMAUDIO3 0x0162 // Windows Media Audio Pro
#endif
#ifndef WAVE_FORMAT_WMASPDIF
#define WAVE_FORMAT_WMASPDIF 0x0164 // Windows Media Audio over S/PDIF
#endif
#ifndef WAVE_FORMAT_EXTENSIBLE
#define WAVE_FORMAT_EXTENSIBLE 0xFFFE // All WAVEFORMATEXTENSIBLE formats
#endif
/**************************************************************************
*
* Define the most common wave format GUIDs used in WAVEFORMATEXTENSIBLE
* formats. Note that including the Windows ksmedia.h header after this
* one will cause build problems; this cannot be avoided, since ksmedia.h
* defines these macros without preprocessor guards.
*
***************************************************************************/
#ifdef __cplusplus // uuid() and __uuidof() are only available in C++
#ifndef KSDATAFORMAT_SUBTYPE_PCM
struct __declspec(uuid("00000001-0000-0010-8000-00aa00389b71")) KSDATAFORMAT_SUBTYPE_PCM_STRUCT;
#define KSDATAFORMAT_SUBTYPE_PCM __uuidof(KSDATAFORMAT_SUBTYPE_PCM_STRUCT)
#endif
#ifndef KSDATAFORMAT_SUBTYPE_ADPCM
struct __declspec(uuid("00000002-0000-0010-8000-00aa00389b71")) KSDATAFORMAT_SUBTYPE_ADPCM_STRUCT;
#define KSDATAFORMAT_SUBTYPE_ADPCM __uuidof(KSDATAFORMAT_SUBTYPE_ADPCM_STRUCT)
#endif
#ifndef KSDATAFORMAT_SUBTYPE_IEEE_FLOAT
struct __declspec(uuid("00000003-0000-0010-8000-00aa00389b71")) KSDATAFORMAT_SUBTYPE_IEEE_FLOAT_STRUCT;
#define KSDATAFORMAT_SUBTYPE_IEEE_FLOAT __uuidof(KSDATAFORMAT_SUBTYPE_IEEE_FLOAT_STRUCT)
#endif
#endif
/**************************************************************************
*
* Speaker positions used in the WAVEFORMATEXTENSIBLE dwChannelMask field.
*
***************************************************************************/
#ifndef SPEAKER_FRONT_LEFT
#define SPEAKER_FRONT_LEFT 0x00000001
#define SPEAKER_FRONT_RIGHT 0x00000002
#define SPEAKER_FRONT_CENTER 0x00000004
#define SPEAKER_LOW_FREQUENCY 0x00000008
#define SPEAKER_BACK_LEFT 0x00000010
#define SPEAKER_BACK_RIGHT 0x00000020
#define SPEAKER_FRONT_LEFT_OF_CENTER 0x00000040
#define SPEAKER_FRONT_RIGHT_OF_CENTER 0x00000080
#define SPEAKER_BACK_CENTER 0x00000100
#define SPEAKER_SIDE_LEFT 0x00000200
#define SPEAKER_SIDE_RIGHT 0x00000400
#define SPEAKER_TOP_CENTER 0x00000800
#define SPEAKER_TOP_FRONT_LEFT 0x00001000
#define SPEAKER_TOP_FRONT_CENTER 0x00002000
#define SPEAKER_TOP_FRONT_RIGHT 0x00004000
#define SPEAKER_TOP_BACK_LEFT 0x00008000
#define SPEAKER_TOP_BACK_CENTER 0x00010000
#define SPEAKER_TOP_BACK_RIGHT 0x00020000
#define SPEAKER_RESERVED 0x7FFC0000
#define SPEAKER_ALL 0x80000000
#define _SPEAKER_POSITIONS_
#endif
#ifndef SPEAKER_STEREO
#define SPEAKER_MONO (SPEAKER_FRONT_CENTER)
#define SPEAKER_STEREO (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT)
#define SPEAKER_2POINT1 (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_LOW_FREQUENCY)
#define SPEAKER_SURROUND (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_FRONT_CENTER | SPEAKER_BACK_CENTER)
#define SPEAKER_QUAD (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_BACK_LEFT | SPEAKER_BACK_RIGHT)
#define SPEAKER_4POINT1 (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_LOW_FREQUENCY | SPEAKER_BACK_LEFT | SPEAKER_BACK_RIGHT)
#define SPEAKER_5POINT1 (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_FRONT_CENTER | SPEAKER_LOW_FREQUENCY | SPEAKER_BACK_LEFT | SPEAKER_BACK_RIGHT)
#define SPEAKER_7POINT1 (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_FRONT_CENTER | SPEAKER_LOW_FREQUENCY | SPEAKER_BACK_LEFT | SPEAKER_BACK_RIGHT | SPEAKER_FRONT_LEFT_OF_CENTER | SPEAKER_FRONT_RIGHT_OF_CENTER)
#define SPEAKER_5POINT1_SURROUND (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_FRONT_CENTER | SPEAKER_LOW_FREQUENCY | SPEAKER_SIDE_LEFT | SPEAKER_SIDE_RIGHT)
#define SPEAKER_7POINT1_SURROUND (SPEAKER_FRONT_LEFT | SPEAKER_FRONT_RIGHT | SPEAKER_FRONT_CENTER | SPEAKER_LOW_FREQUENCY | SPEAKER_BACK_LEFT | SPEAKER_BACK_RIGHT | SPEAKER_SIDE_LEFT | SPEAKER_SIDE_RIGHT)
#endif
#pragma pack(pop)
#endif // #ifndef __AUDIODEFS_INCLUDED__
-65
View File
@@ -1,65 +0,0 @@
// comdecl.h: Macros to facilitate COM interface and GUID declarations.
// Copyright (c) Microsoft Corporation. All rights reserved.
#ifndef _COMDECL_H_
#define _COMDECL_H_
#ifndef _XBOX
#include <basetyps.h> // For standard COM interface macros
#else
#pragma warning(push)
#pragma warning(disable:4061)
#include <xtl.h> // Required by xobjbase.h
#include <xobjbase.h> // Special definitions for Xbox build
#pragma warning(pop)
#endif
// The DEFINE_CLSID() and DEFINE_IID() macros defined below allow COM GUIDs to
// be declared and defined in such a way that clients can obtain the GUIDs using
// either the __uuidof() extension or the old-style CLSID_Foo / IID_IFoo names.
// If using the latter approach, the client can also choose whether to get the
// GUID definitions by defining the INITGUID preprocessor constant or by linking
// to a GUID library. This works in either C or C++.
#ifndef _MSC_VER
#define DEFINE_UUID(name, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) __CRT_UUID_DECL(name, 0x##l, 0x##w1, 0x##w2, 0x##b1, 0x##b2, 0x##b3, 0x##b4, 0x##b5, 0x##b6, 0x##b7, 0x##b8)
#define DEFINE_CLSID(className, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) class className; DEFINE_UUID(className, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8)
#define DEFINE_IID(interfaceName, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) struct interfaceName; DEFINE_UUID(interfaceName, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8)
#elif __cplusplus
#define DECLSPEC_UUID_WRAPPER(x) __declspec(uuid(#x))
#ifdef INITGUID
#define DEFINE_CLSID(className, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
class DECLSPEC_UUID_WRAPPER(l##-##w1##-##w2##-##b1##b2##-##b3##b4##b5##b6##b7##b8) className; \
EXTERN_C const GUID DECLSPEC_SELECTANY CLSID_##className = __uuidof(className)
#define DEFINE_IID(interfaceName, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
interface DECLSPEC_UUID_WRAPPER(l##-##w1##-##w2##-##b1##b2##-##b3##b4##b5##b6##b7##b8) interfaceName; \
EXTERN_C const GUID DECLSPEC_SELECTANY IID_##interfaceName = __uuidof(interfaceName)
#else // INITGUID
#define DEFINE_CLSID(className, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
class DECLSPEC_UUID_WRAPPER(l##-##w1##-##w2##-##b1##b2##-##b3##b4##b5##b6##b7##b8) className; \
EXTERN_C const GUID CLSID_##className
#define DEFINE_IID(interfaceName, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
interface DECLSPEC_UUID_WRAPPER(l##-##w1##-##w2##-##b1##b2##-##b3##b4##b5##b6##b7##b8) interfaceName; \
EXTERN_C const GUID IID_##interfaceName
#endif // INITGUID
#else // __cplusplus
#define DEFINE_CLSID(className, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
DEFINE_GUID(CLSID_##className, 0x##l, 0x##w1, 0x##w2, 0x##b1, 0x##b2, 0x##b3, 0x##b4, 0x##b5, 0x##b6, 0x##b7, 0x##b8)
#define DEFINE_IID(interfaceName, l, w1, w2, b1, b2, b3, b4, b5, b6, b7, b8) \
DEFINE_GUID(IID_##interfaceName, 0x##l, 0x##w1, 0x##w2, 0x##b1, 0x##b2, 0x##b3, 0x##b4, 0x##b5, 0x##b6, 0x##b7, 0x##b8)
#endif // __cplusplus
#endif // #ifndef _COMDECL_H_
-18
View File
@@ -1,18 +0,0 @@
/*==========================================================================;
*
*
* File: dxsdkver.h
* Content: DirectX SDK Version Include File
*
****************************************************************************/
#ifndef _DXSDKVER_H_
#define _DXSDKVER_H_
#define _DXSDK_PRODUCT_MAJOR 9
#define _DXSDK_PRODUCT_MINOR 29
#define _DXSDK_BUILD_MAJOR 1962
#define _DXSDK_BUILD_MINOR 0
#endif // _DXSDKVER_H_
-718
View File
@@ -1,718 +0,0 @@
/***************************************************************************
*
* Copyright (c) Microsoft Corporation. All rights reserved.
*
* File: xma2defs.h
* Content: Constants, data types and functions for XMA2 compressed audio.
*
***************************************************************************/
#ifndef __XMA2DEFS_INCLUDED__
#define __XMA2DEFS_INCLUDED__
#include <sal.h> // Markers for documenting API semantics
#include <winerror.h> // For S_OK, E_FAIL
#include <audiodefs.h> // Basic data types and constants for audio work
/***************************************************************************
* Overview
***************************************************************************/
// A typical XMA2 file contains these RIFF chunks:
//
// 'fmt' or 'XMA2' chunk (or both): A description of the XMA data's structure
// and characteristics (length, channels, sample rate, loops, block size, etc).
//
// 'seek' chunk: A seek table to help navigate the XMA data.
//
// 'data' chunk: The encoded XMA2 data.
//
// The encoded XMA2 data is structured as a set of BLOCKS, which contain PACKETS,
// which contain FRAMES, which contain SUBFRAMES (roughly speaking). The frames
// in a file may also be divided into several subsets, called STREAMS.
//
// FRAME: A variable-sized segment of XMA data that decodes to exactly 512 mono
// or stereo PCM samples. This is the smallest unit of XMA data that can
// be decoded in isolation. Frames are an arbitrary number of bits in
// length, and need not be byte-aligned. See "XMA frame structure" below.
//
// SUBFRAME: A region of bits in an XMA frame that decodes to 128 mono or stereo
// samples. The XMA decoder cannot decode a subframe in isolation; it needs
// a whole frame to work with. However, it can begin emitting the frame's
// decoded samples at any one of the four subframe boundaries. Subframes
// can be addressed for seeking and looping purposes.
//
// PACKET: A 2Kb region containing a 32-bit header and some XMA frames. Frames
// can (and usually do) span packets. A packet's header includes the offset
// in bits of the first frame that begins within that packet. All of the
// frames that begin in a given packet belong to the same "stream" (see the
// Multichannel Audio section below).
//
// STREAM: A set of packets within an XMA file that all contain data for the
// same mono or stereo component of a PCM file with more than two channels.
// The packets comprising a given stream may be interleaved with each other
// more or less arbitrarily; see Multichannel Audio.
//
// BLOCK: An array of XMA packets; or, to break it down differently, a series of
// consecutive XMA frames, padded at the end with reserved data. A block
// must contain at least one 2Kb packet per stream, and it can hold up to
// 4095 packets (8190Kb), but its size is typically in the 32Kb-128Kb range.
// (The size chosen involves a trade-off between memory use and efficiency
// of reading from permanent storage.)
//
// XMA frames do not span blocks, so a block is guaranteed to begin with a
// set of complete frames, one per stream. Also, a block in a multi-stream
// XMA2 file always contains the same number of samples for each stream;
// see Multichannel Audio.
//
// The 'data' chunk in an XMA2 file is an array of XMA2WAVEFORMAT.BlockCount XMA
// blocks, all the same size (as specified in XMA2WAVEFORMAT.BlockSizeInBytes)
// except for the last one, which may be shorter.
// MULTICHANNEL AUDIO: the XMA decoder can only decode raw XMA data into either
// mono or stereo PCM data. In order to encode a 6-channel file (say), the file
// must be deinterleaved into 3 stereo streams that are encoded independently,
// producing 3 encoded XMA data streams. Then the packets in these 3 streams
// are interleaved to produce a single XMA2 file, and some information is added
// to the file so that the original 6-channel audio can be reconstructed at
// decode time. This works using the concept of an XMA stream (see above).
//
// The frames for all the streams in an XMA file are interleaved in an arbitrary
// order. To locate a frame that belongs to a given stream in a given XMA block,
// you must examine the first few packets in the block. Here (and only here) the
// packets are guaranteed to be presented in stream order, so that all frames
// beginning in packet 0 belong to stream 0 (the first stereo pair), etc.
//
// (This means that when decoding multi-stream XMA files, only entire XMA blocks
// should be submitted to the decoder; otherwise it cannot know which frames
// belong to which stream.)
//
// Once you have one frame that belongs to a given stream, you can find the next
// one by looking at the frame's 'NextFrameOffsetBits' value (which is stored in
// its first 15 bits; see XMAFRAME below). The GetXmaFrameBitPosition function
// uses this technique.
// SEEKING IN XMA2 FILES: Here is some pseudocode to find the byte position and
// subframe in an XMA2 file which will contain sample S when decoded.
//
// 1. Traverse the seek table to find the XMA2 block containing sample S. The
// seek table is an array of big-endian DWORDs, one per block in the file.
// The Nth DWORD is the total number of PCM samples that would be obtained
// by decoding the entire XMA file up to the end of block N. Hence, the
// block we want is the first one whose seek table entry is greater than S.
// (See the GetXmaBlockContainingSample helper function.)
//
// 2. Calculate which frame F within the block found above contains sample S.
// Since each frame decodes to 512 samples, this is straightforward. The
// first frame in the block produces samples X to X + 512, where X is the
// seek table entry for the prior block. So F is (S - X) / 512.
//
// 3. Find the bit offset within the block where frame F starts. Since frames
// are variable-sized, this can only be done by traversing all the frames in
// the block until we reach frame F. (See GetXmaFrameBitPosition.)
//
// 4. Frame F has four 128-sample subframes. To find the subframe containing S,
// we can use the formula (S % 512) / 128.
//
// In the case of multi-stream XMA files, sample S is a multichannel sample with
// parts coming from several frames, one per stream. To find all these frames,
// steps 2-4 need to be repeated for each stream N, using the knowledge that the
// first packets in a block are presented in stream order. The frame traversal
// in step 3 must be started at the first frame in the Nth packet of the block,
// which will be the first frame for stream N. (And the packet header will tell
// you the first frame's start position within the packet.)
//
// Step 1 can be performed using the GetXmaBlockContainingSample function below,
// and steps 2-4 by calling GetXmaDecodePositionForSample once for each stream.
/***************************************************************************
* XMA constants
***************************************************************************/
// Size of the PCM samples produced by the XMA decoder
#define XMA_OUTPUT_SAMPLE_BYTES 2u
#define XMA_OUTPUT_SAMPLE_BITS (XMA_OUTPUT_SAMPLE_BYTES * 8u)
// Size of an XMA packet
#define XMA_BYTES_PER_PACKET 2048u
#define XMA_BITS_PER_PACKET (XMA_BYTES_PER_PACKET * 8u)
// Size of an XMA packet header
#define XMA_PACKET_HEADER_BYTES 4u
#define XMA_PACKET_HEADER_BITS (XMA_PACKET_HEADER_BYTES * 8u)
// Sample blocks in a decoded XMA frame
#define XMA_SAMPLES_PER_FRAME 512u
// Sample blocks in a decoded XMA subframe
#define XMA_SAMPLES_PER_SUBFRAME 128u
// Maximum encoded data that can be submitted to the XMA decoder at a time
#define XMA_READBUFFER_MAX_PACKETS 4095u
#define XMA_READBUFFER_MAX_BYTES (XMA_READBUFFER_MAX_PACKETS * XMA_BYTES_PER_PACKET)
// Maximum size allowed for the XMA decoder's output buffers
#define XMA_WRITEBUFFER_MAX_BYTES (31u * 256u)
// Required byte alignment of the XMA decoder's output buffers
#define XMA_WRITEBUFFER_BYTE_ALIGNMENT 256u
// Decode chunk sizes for the XMA_PLAYBACK_INIT.subframesToDecode field
#define XMA_MIN_SUBFRAMES_TO_DECODE 1u
#define XMA_MAX_SUBFRAMES_TO_DECODE 8u
#define XMA_OPTIMAL_SUBFRAMES_TO_DECODE 4u
// LoopCount<255 means finite repetitions; LoopCount=255 means infinite looping
#define XMA_MAX_LOOPCOUNT 254u
#define XMA_INFINITE_LOOP 255u
/***************************************************************************
* XMA format structures
***************************************************************************/
// The currently recommended way to express format information for XMA2 files
// is the XMA2WAVEFORMATEX structure. This structure is fully compliant with
// the WAVEFORMATEX standard and contains all the information needed to parse
// and manage XMA2 files in a compact way.
#define WAVE_FORMAT_XMA2 0x166
typedef struct XMA2WAVEFORMATEX
{
WAVEFORMATEX wfx;
// Meaning of the WAVEFORMATEX fields here:
// wFormatTag; // Audio format type; always WAVE_FORMAT_XMA2
// nChannels; // Channel count of the decoded audio
// nSamplesPerSec; // Sample rate of the decoded audio
// nAvgBytesPerSec; // Used internally by the XMA encoder
// nBlockAlign; // Decoded sample size; channels * wBitsPerSample / 8
// wBitsPerSample; // Bits per decoded mono sample; always 16 for XMA
// cbSize; // Size in bytes of the rest of this structure (34)
WORD NumStreams; // Number of audio streams (1 or 2 channels each)
DWORD ChannelMask; // Spatial positions of the channels in this file,
// stored as SPEAKER_xxx values (see audiodefs.h)
DWORD SamplesEncoded; // Total number of PCM samples the file decodes to
DWORD BytesPerBlock; // XMA block size (but the last one may be shorter)
DWORD PlayBegin; // First valid sample in the decoded audio
DWORD PlayLength; // Length of the valid part of the decoded audio
DWORD LoopBegin; // Beginning of the loop region in decoded sample terms
DWORD LoopLength; // Length of the loop region in decoded sample terms
BYTE LoopCount; // Number of loop repetitions; 255 = infinite
BYTE EncoderVersion; // Version of XMA encoder that generated the file
WORD BlockCount; // XMA blocks in file (and entries in its seek table)
} XMA2WAVEFORMATEX, *PXMA2WAVEFORMATEX;
// The legacy XMA format structures are described here for reference, but they
// should not be used in new content. XMAWAVEFORMAT was the structure used in
// XMA version 1 files. XMA2WAVEFORMAT was used in early XMA2 files; it is not
// placed in the usual 'fmt' RIFF chunk but in its own 'XMA2' chunk.
#ifndef WAVE_FORMAT_XMA
#define WAVE_FORMAT_XMA 0x0165
// Values used in the ChannelMask fields below. Similar to the SPEAKER_xxx
// values defined in audiodefs.h, but modified to fit in a single byte.
#ifndef XMA_SPEAKER_LEFT
#define XMA_SPEAKER_LEFT 0x01
#define XMA_SPEAKER_RIGHT 0x02
#define XMA_SPEAKER_CENTER 0x04
#define XMA_SPEAKER_LFE 0x08
#define XMA_SPEAKER_LEFT_SURROUND 0x10
#define XMA_SPEAKER_RIGHT_SURROUND 0x20
#define XMA_SPEAKER_LEFT_BACK 0x40
#define XMA_SPEAKER_RIGHT_BACK 0x80
#endif
// Used in XMAWAVEFORMAT for per-stream data
typedef struct XMASTREAMFORMAT
{
DWORD PsuedoBytesPerSec; // Used by the XMA encoder (typo preserved for legacy reasons)
DWORD SampleRate; // The stream's decoded sample rate (in XMA2 files,
// this is the same for all streams in the file).
DWORD LoopStart; // Bit offset of the frame containing the loop start
// point, relative to the beginning of the stream.
DWORD LoopEnd; // Bit offset of the frame containing the loop end.
BYTE SubframeData; // Two 4-bit numbers specifying the exact location of
// the loop points within the frames that contain them.
// SubframeEnd: Subframe of the loop end frame where
// the loop ends. Ranges from 0 to 3.
// SubframeSkip: Subframes to skip in the start frame to
// reach the loop. Ranges from 0 to 4.
BYTE Channels; // Number of channels in the stream (1 or 2)
WORD ChannelMask; // Spatial positions of the channels in the stream
} XMASTREAMFORMAT;
// Legacy XMA1 format structure
typedef struct XMAWAVEFORMAT
{
WORD FormatTag; // Audio format type (always WAVE_FORMAT_XMA)
WORD BitsPerSample; // Bit depth (currently required to be 16)
WORD EncodeOptions; // Options for XMA encoder/decoder
WORD LargestSkip; // Largest skip used in interleaving streams
WORD NumStreams; // Number of interleaved audio streams
BYTE LoopCount; // Number of loop repetitions; 255 = infinite
BYTE Version; // XMA encoder version that generated the file.
// Always 3 or higher for XMA2 files.
XMASTREAMFORMAT XmaStreams[1]; // Per-stream format information; the actual
// array length is in the NumStreams field.
} XMAWAVEFORMAT;
// Used in XMA2WAVEFORMAT for per-stream data
typedef struct XMA2STREAMFORMAT
{
BYTE Channels; // Number of channels in the stream (1 or 2)
BYTE RESERVED; // Reserved for future use
WORD ChannelMask; // Spatial positions of the channels in the stream
} XMA2STREAMFORMAT;
// Legacy XMA2 format structure (big-endian byte ordering)
typedef struct XMA2WAVEFORMAT
{
BYTE Version; // XMA encoder version that generated the file.
// Always 3 or higher for XMA2 files.
BYTE NumStreams; // Number of interleaved audio streams
BYTE RESERVED; // Reserved for future use
BYTE LoopCount; // Number of loop repetitions; 255 = infinite
DWORD LoopBegin; // Loop begin point, in samples
DWORD LoopEnd; // Loop end point, in samples
DWORD SampleRate; // The file's decoded sample rate
DWORD EncodeOptions; // Options for the XMA encoder/decoder
DWORD PsuedoBytesPerSec; // Used internally by the XMA encoder
DWORD BlockSizeInBytes; // Size in bytes of this file's XMA blocks (except
// possibly the last one). Always a multiple of
// 2Kb, since XMA blocks are arrays of 2Kb packets.
DWORD SamplesEncoded; // Total number of PCM samples encoded in this file
DWORD SamplesInSource; // Actual number of PCM samples in the source
// material used to generate this file
DWORD BlockCount; // Number of XMA blocks in this file (and hence
// also the number of entries in its seek table)
XMA2STREAMFORMAT Streams[1]; // Per-stream format information; the actual
// array length is in the NumStreams field.
} XMA2WAVEFORMAT;
#endif // #ifndef WAVE_FORMAT_XMA
/***************************************************************************
* XMA packet structure (in big-endian form)
***************************************************************************/
typedef struct XMA2PACKET
{
int FrameCount : 6; // Number of XMA frames that begin in this packet
int FrameOffsetInBits : 15; // Bit of XmaData where the first complete frame begins
int PacketMetaData : 3; // Metadata stored in the packet (always 1 for XMA2)
int PacketSkipCount : 8; // How many packets belonging to other streams must be
// skipped to find the next packet belonging to this one
BYTE XmaData[XMA_BYTES_PER_PACKET - sizeof(DWORD)]; // XMA encoded data
} XMA2PACKET;
// E.g. if the first DWORD of a packet is 0x30107902:
//
// 001100 000001000001111 001 00000010
// | | | |____ Skip 2 packets to find the next one for this stream
// | | |___________ XMA2 signature (always 001)
// | |_____________________ First frame starts 527 bits into packet
// |________________________________ Packet contains 12 frames
// Helper functions to extract the fields above from an XMA packet. (Note that
// the bitfields cannot be read directly on little-endian architectures such as
// the Intel x86, as they are laid out in big-endian form.)
__inline DWORD GetXmaPacketFrameCount(__in_bcount(1) const BYTE* pPacket)
{
return (DWORD)(pPacket[0] >> 2);
}
__inline DWORD GetXmaPacketFirstFrameOffsetInBits(__in_bcount(3) const BYTE* pPacket)
{
return ((DWORD)(pPacket[0] & 0x3) << 13) |
((DWORD)(pPacket[1]) << 5) |
((DWORD)(pPacket[2]) >> 3);
}
__inline DWORD GetXmaPacketMetadata(__in_bcount(3) const BYTE* pPacket)
{
return (DWORD)(pPacket[2] & 0x7);
}
__inline DWORD GetXmaPacketSkipCount(__in_bcount(4) const BYTE* pPacket)
{
return (DWORD)(pPacket[3]);
}
/***************************************************************************
* XMA frame structure
***************************************************************************/
// There is no way to represent the XMA frame as a C struct, since it is a
// variable-sized string of bits that need not be stored at a byte-aligned
// position in memory. This is the layout:
//
// XMAFRAME
// {
// LengthInBits: A 15-bit number representing the length of this frame.
// XmaData: Encoded XMA data; its size in bits is (LengthInBits - 15).
// }
// Size in bits of the frame's initial LengthInBits field
#define XMA_BITS_IN_FRAME_LENGTH_FIELD 15
// Special LengthInBits value that marks an invalid final frame
#define XMA_FINAL_FRAME_MARKER 0x7FFF
/***************************************************************************
* XMA helper functions
***************************************************************************/
// We define a local ASSERT macro to equal the global one if it exists.
// You can define XMA2DEFS_ASSERT in advance to override this default.
#ifndef XMA2DEFS_ASSERT
#ifdef ASSERT
#define XMA2DEFS_ASSERT ASSERT
#else
#define XMA2DEFS_ASSERT(a) /* No-op by default */
#endif
#endif
// GetXmaBlockContainingSample: Use a given seek table to find the XMA block
// containing a given decoded sample. Note that the seek table entries in an
// XMA file are stored in big-endian form and may need to be converted prior
// to calling this function.
__inline HRESULT GetXmaBlockContainingSample
(
DWORD nBlockCount, // Blocks in the file (= seek table entries)
__in_ecount(nBlockCount) const DWORD* pSeekTable, // Pointer to the seek table data
DWORD nDesiredSample, // Decoded sample to locate
__out DWORD* pnBlockContainingSample, // Index of the block containing the sample
__out DWORD* pnSampleOffsetWithinBlock // Position of the sample in this block
)
{
DWORD nPreviousTotalSamples = 0;
DWORD nBlock;
DWORD nTotalSamplesSoFar;
XMA2DEFS_ASSERT(pSeekTable);
XMA2DEFS_ASSERT(pnBlockContainingSample);
XMA2DEFS_ASSERT(pnSampleOffsetWithinBlock);
for (nBlock = 0; nBlock < nBlockCount; ++nBlock)
{
nTotalSamplesSoFar = pSeekTable[nBlock];
if (nTotalSamplesSoFar > nDesiredSample)
{
*pnBlockContainingSample = nBlock;
*pnSampleOffsetWithinBlock = nDesiredSample - nPreviousTotalSamples;
return S_OK;
}
nPreviousTotalSamples = nTotalSamplesSoFar;
}
return E_FAIL;
}
// GetXmaFrameLengthInBits: Reads a given frame's LengthInBits field.
__inline DWORD GetXmaFrameLengthInBits
(
__in_bcount(nBitPosition / 8 + 3)
__in const BYTE* pPacket, // Pointer to XMA packet[s] containing the frame
DWORD nBitPosition // Bit offset of the frame within this packet
)
{
DWORD nRegion;
DWORD nBytePosition = nBitPosition / 8;
DWORD nBitOffset = nBitPosition % 8;
if (nBitOffset < 2) // Only need to read 2 bytes (and might not be safe to read more)
{
nRegion = (DWORD)(pPacket[nBytePosition+0]) << 8 |
(DWORD)(pPacket[nBytePosition+1]);
return (nRegion >> (1 - nBitOffset)) & 0x7FFF; // Last 15 bits
}
else // Need to read 3 bytes
{
nRegion = (DWORD)(pPacket[nBytePosition+0]) << 16 |
(DWORD)(pPacket[nBytePosition+1]) << 8 |
(DWORD)(pPacket[nBytePosition+2]);
return (nRegion >> (9 - nBitOffset)) & 0x7FFF; // Last 15 bits
}
}
// GetXmaFrameBitPosition: Calculates the bit offset of a given frame within
// an XMA block or set of blocks. Returns 0 on failure.
__inline DWORD GetXmaFrameBitPosition
(
__in_bcount(nXmaDataBytes) const BYTE* pXmaData, // Pointer to XMA block[s]
DWORD nXmaDataBytes, // Size of pXmaData in bytes
DWORD nStreamIndex, // Stream within which to seek
DWORD nDesiredFrame // Frame sought
)
{
const BYTE* pCurrentPacket;
DWORD nPacketsExamined = 0;
DWORD nFrameCountSoFar = 0;
DWORD nFramesToSkip;
DWORD nFrameBitOffset;
XMA2DEFS_ASSERT(pXmaData);
XMA2DEFS_ASSERT(nXmaDataBytes % XMA_BYTES_PER_PACKET == 0);
// Get the first XMA packet belonging to the desired stream, relying on the
// fact that the first packets for each stream are in consecutive order at
// the beginning of an XMA block.
pCurrentPacket = pXmaData + nStreamIndex * XMA_BYTES_PER_PACKET;
for (;;)
{
// If we have exceeded the size of the XMA data, return failure
if (pCurrentPacket + XMA_BYTES_PER_PACKET > pXmaData + nXmaDataBytes)
{
return 0;
}
// If the current packet contains the frame we are looking for...
if (nFrameCountSoFar + GetXmaPacketFrameCount(pCurrentPacket) > nDesiredFrame)
{
// See how many frames in this packet we need to skip to get to it
XMA2DEFS_ASSERT(nDesiredFrame >= nFrameCountSoFar);
nFramesToSkip = nDesiredFrame - nFrameCountSoFar;
// Get the bit offset of the first frame in this packet
nFrameBitOffset = XMA_PACKET_HEADER_BITS + GetXmaPacketFirstFrameOffsetInBits(pCurrentPacket);
// Advance nFrameBitOffset to the frame of interest
while (nFramesToSkip--)
{
nFrameBitOffset += GetXmaFrameLengthInBits(pCurrentPacket, nFrameBitOffset);
}
// The bit offset to return is the number of bits from pXmaData to
// pCurrentPacket plus the bit offset of the frame of interest
return (DWORD)(pCurrentPacket - pXmaData) * 8 + nFrameBitOffset;
}
// If we haven't found the right packet yet, advance our counters
++nPacketsExamined;
nFrameCountSoFar += GetXmaPacketFrameCount(pCurrentPacket);
// And skip to the next packet belonging to the same stream
pCurrentPacket += XMA_BYTES_PER_PACKET * (GetXmaPacketSkipCount(pCurrentPacket) + 1);
}
}
// GetLastXmaFrameBitPosition: Calculates the bit offset of the last complete
// frame in an XMA block or set of blocks.
__inline DWORD GetLastXmaFrameBitPosition
(
__in_bcount(nXmaDataBytes) const BYTE* pXmaData, // Pointer to XMA block[s]
DWORD nXmaDataBytes, // Size of pXmaData in bytes
DWORD nStreamIndex // Stream within which to seek
)
{
const BYTE* pLastPacket;
DWORD nBytesToNextPacket;
DWORD nFrameBitOffset;
DWORD nFramesInLastPacket;
XMA2DEFS_ASSERT(pXmaData);
XMA2DEFS_ASSERT(nXmaDataBytes % XMA_BYTES_PER_PACKET == 0);
XMA2DEFS_ASSERT(nXmaDataBytes >= XMA_BYTES_PER_PACKET * (nStreamIndex + 1));
// Get the first XMA packet belonging to the desired stream, relying on the
// fact that the first packets for each stream are in consecutive order at
// the beginning of an XMA block.
pLastPacket = pXmaData + nStreamIndex * XMA_BYTES_PER_PACKET;
// Search for the last packet belonging to the desired stream
for (;;)
{
nBytesToNextPacket = XMA_BYTES_PER_PACKET * (GetXmaPacketSkipCount(pLastPacket) + 1);
XMA2DEFS_ASSERT(nBytesToNextPacket);
if (pLastPacket + nBytesToNextPacket + XMA_BYTES_PER_PACKET > pXmaData + nXmaDataBytes)
{
break; // The next packet would extend beyond the end of pXmaData
}
pLastPacket += nBytesToNextPacket;
}
// The last packet can sometimes have no seekable frames, in which case we
// have to use the previous one
if (GetXmaPacketFrameCount(pLastPacket) == 0)
{
pLastPacket -= nBytesToNextPacket;
}
// Found the last packet. Get the bit offset of its first frame.
nFrameBitOffset = XMA_PACKET_HEADER_BITS + GetXmaPacketFirstFrameOffsetInBits(pLastPacket);
// Traverse frames until we reach the last one
nFramesInLastPacket = GetXmaPacketFrameCount(pLastPacket);
while (--nFramesInLastPacket)
{
nFrameBitOffset += GetXmaFrameLengthInBits(pLastPacket, nFrameBitOffset);
}
// The bit offset to return is the number of bits from pXmaData to
// pLastPacket plus the offset of the last frame in this packet.
return (DWORD)(pLastPacket - pXmaData) * 8 + nFrameBitOffset;
}
// GetXmaDecodePositionForSample: Obtains the information needed to make the
// decoder generate audio starting at a given sample position relative to the
// beginning of the given XMA block: the bit offset of the appropriate frame,
// and the right subframe within that frame. This data can be passed directly
// to the XMAPlaybackSetDecodePosition function.
__inline HRESULT GetXmaDecodePositionForSample
(
__in_bcount(nXmaDataBytes) const BYTE* pXmaData, // Pointer to XMA block[s]
DWORD nXmaDataBytes, // Size of pXmaData in bytes
DWORD nStreamIndex, // Stream within which to seek
DWORD nDesiredSample, // Sample sought
__out DWORD* pnBitOffset, // Returns the bit offset within pXmaData of
// the frame containing the sample sought
__out DWORD* pnSubFrame // Returns the subframe containing the sample
)
{
DWORD nDesiredFrame = nDesiredSample / XMA_SAMPLES_PER_FRAME;
DWORD nSubFrame = (nDesiredSample % XMA_SAMPLES_PER_FRAME) / XMA_SAMPLES_PER_SUBFRAME;
DWORD nBitOffset = GetXmaFrameBitPosition(pXmaData, nXmaDataBytes, nStreamIndex, nDesiredFrame);
XMA2DEFS_ASSERT(pnBitOffset);
XMA2DEFS_ASSERT(pnSubFrame);
if (nBitOffset)
{
*pnBitOffset = nBitOffset;
*pnSubFrame = nSubFrame;
return S_OK;
}
else
{
return E_FAIL;
}
}
// GetXmaSampleRate: Obtains the legal XMA sample rate (24, 32, 44.1 or 48Khz)
// corresponding to a generic sample rate.
__inline DWORD GetXmaSampleRate(DWORD dwGeneralRate)
{
DWORD dwXmaRate = 48000; // Default XMA rate for all rates above 44100Hz
if (dwGeneralRate <= 24000) dwXmaRate = 24000;
else if (dwGeneralRate <= 32000) dwXmaRate = 32000;
else if (dwGeneralRate <= 44100) dwXmaRate = 44100;
return dwXmaRate;
}
// Functions to convert between WAVEFORMATEXTENSIBLE channel masks (combinations
// of the SPEAKER_xxx flags defined in audiodefs.h) and XMA channel masks (which
// are limited to eight possible speaker positions: left, right, center, low
// frequency, side left, side right, back left and back right).
__inline DWORD GetStandardChannelMaskFromXmaMask(BYTE bXmaMask)
{
DWORD dwStandardMask = 0;
if (bXmaMask & XMA_SPEAKER_LEFT) dwStandardMask |= SPEAKER_FRONT_LEFT;
if (bXmaMask & XMA_SPEAKER_RIGHT) dwStandardMask |= SPEAKER_FRONT_RIGHT;
if (bXmaMask & XMA_SPEAKER_CENTER) dwStandardMask |= SPEAKER_FRONT_CENTER;
if (bXmaMask & XMA_SPEAKER_LFE) dwStandardMask |= SPEAKER_LOW_FREQUENCY;
if (bXmaMask & XMA_SPEAKER_LEFT_SURROUND) dwStandardMask |= SPEAKER_SIDE_LEFT;
if (bXmaMask & XMA_SPEAKER_RIGHT_SURROUND) dwStandardMask |= SPEAKER_SIDE_RIGHT;
if (bXmaMask & XMA_SPEAKER_LEFT_BACK) dwStandardMask |= SPEAKER_BACK_LEFT;
if (bXmaMask & XMA_SPEAKER_RIGHT_BACK) dwStandardMask |= SPEAKER_BACK_RIGHT;
return dwStandardMask;
}
__inline BYTE GetXmaChannelMaskFromStandardMask(DWORD dwStandardMask)
{
BYTE bXmaMask = 0;
if (dwStandardMask & SPEAKER_FRONT_LEFT) bXmaMask |= XMA_SPEAKER_LEFT;
if (dwStandardMask & SPEAKER_FRONT_RIGHT) bXmaMask |= XMA_SPEAKER_RIGHT;
if (dwStandardMask & SPEAKER_FRONT_CENTER) bXmaMask |= XMA_SPEAKER_CENTER;
if (dwStandardMask & SPEAKER_LOW_FREQUENCY) bXmaMask |= XMA_SPEAKER_LFE;
if (dwStandardMask & SPEAKER_SIDE_LEFT) bXmaMask |= XMA_SPEAKER_LEFT_SURROUND;
if (dwStandardMask & SPEAKER_SIDE_RIGHT) bXmaMask |= XMA_SPEAKER_RIGHT_SURROUND;
if (dwStandardMask & SPEAKER_BACK_LEFT) bXmaMask |= XMA_SPEAKER_LEFT_BACK;
if (dwStandardMask & SPEAKER_BACK_RIGHT) bXmaMask |= XMA_SPEAKER_RIGHT_BACK;
return bXmaMask;
}
// LocalizeXma2Format: Modifies a XMA2WAVEFORMATEX structure in place to comply
// with the current platform's byte-ordering rules (little- or big-endian).
__inline HRESULT LocalizeXma2Format(__inout XMA2WAVEFORMATEX* pXma2Format)
{
#define XMASWAP2BYTES(n) ((WORD)(((n) >> 8) | (((n) & 0xff) << 8)))
#define XMASWAP4BYTES(n) ((DWORD)((n) >> 24 | (n) << 24 | ((n) & 0xff00) << 8 | ((n) & 0xff0000) >> 8))
if (pXma2Format->wfx.wFormatTag == WAVE_FORMAT_XMA2)
{
return S_OK;
}
else if (XMASWAP2BYTES(pXma2Format->wfx.wFormatTag) == WAVE_FORMAT_XMA2)
{
pXma2Format->wfx.wFormatTag = XMASWAP2BYTES(pXma2Format->wfx.wFormatTag);
pXma2Format->wfx.nChannels = XMASWAP2BYTES(pXma2Format->wfx.nChannels);
pXma2Format->wfx.nSamplesPerSec = XMASWAP4BYTES(pXma2Format->wfx.nSamplesPerSec);
pXma2Format->wfx.nAvgBytesPerSec = XMASWAP4BYTES(pXma2Format->wfx.nAvgBytesPerSec);
pXma2Format->wfx.nBlockAlign = XMASWAP2BYTES(pXma2Format->wfx.nBlockAlign);
pXma2Format->wfx.wBitsPerSample = XMASWAP2BYTES(pXma2Format->wfx.wBitsPerSample);
pXma2Format->wfx.cbSize = XMASWAP2BYTES(pXma2Format->wfx.cbSize);
pXma2Format->NumStreams = XMASWAP2BYTES(pXma2Format->NumStreams);
pXma2Format->ChannelMask = XMASWAP4BYTES(pXma2Format->ChannelMask);
pXma2Format->SamplesEncoded = XMASWAP4BYTES(pXma2Format->SamplesEncoded);
pXma2Format->BytesPerBlock = XMASWAP4BYTES(pXma2Format->BytesPerBlock);
pXma2Format->PlayBegin = XMASWAP4BYTES(pXma2Format->PlayBegin);
pXma2Format->PlayLength = XMASWAP4BYTES(pXma2Format->PlayLength);
pXma2Format->LoopBegin = XMASWAP4BYTES(pXma2Format->LoopBegin);
pXma2Format->LoopLength = XMASWAP4BYTES(pXma2Format->LoopLength);
pXma2Format->BlockCount = XMASWAP2BYTES(pXma2Format->BlockCount);
return S_OK;
}
else
{
return E_FAIL; // Not a recognizable XMA2 format
}
#undef XMASWAP2BYTES
#undef XMASWAP4BYTES
}
#endif // #ifndef __XMA2DEFS_INCLUDED__
Vendored Submodule
+1
Submodule 3rdparty/curl added at aa1a12cb23
+10 -10
View File
@@ -1,17 +1,17 @@
#pragma once
#if defined(DISCORD_DYNAMIC_LIB)
# if defined(_WIN32)
# if defined(DISCORD_BUILDING_SDK)
# define DISCORD_EXPORT __declspec(dllexport)
# else
# define DISCORD_EXPORT __declspec(dllimport)
# endif
# else
# define DISCORD_EXPORT __attribute__((visibility("default")))
# endif
#if defined(_WIN32)
#if defined(DISCORD_BUILDING_SDK)
#define DISCORD_EXPORT __declspec(dllexport)
#else
# define DISCORD_EXPORT
#define DISCORD_EXPORT __declspec(dllimport)
#endif
#else
#define DISCORD_EXPORT __attribute__((visibility("default")))
#endif
#else
#define DISCORD_EXPORT
#endif
#ifdef __cplusplus
+4 -4
View File
@@ -41,20 +41,20 @@ typedef struct DiscordRichPresence {
int8_t instance;
} DiscordRichPresence;
typedef struct DiscordJoinRequest {
typedef struct DiscordUser {
const char* userId;
const char* username;
const char* discriminator;
const char* avatar;
} DiscordJoinRequest;
} DiscordUser;
typedef struct DiscordEventHandlers {
void (*ready)(void);
void (*ready)(const DiscordUser* request);
void (*disconnected)(int errorCode, const char* message);
void (*errored)(int errorCode, const char* message);
void (*joinGame)(const char* joinSecret);
void (*spectateGame)(const char* spectateSecret);
void (*joinRequest)(const DiscordJoinRequest* request);
void (*joinRequest)(const DiscordUser* request);
} DiscordEventHandlers;
#define DISCORD_REPLY_NO 0
Binary file not shown.
Vendored Submodule
+1
Submodule 3rdparty/flatbuffers added at 9e7e8cbe9f
+3 -1
View File
@@ -27,6 +27,9 @@
<CharacterSet>MultiByte</CharacterSet>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">
@@ -55,7 +58,6 @@
<AdditionalIncludeDirectories>hidapi\hidapi;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<PreprocessorDefinitions>WIN32;_DEBUG;_WINDOWS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<BasicRuntimeChecks>EnableFastChecks</BasicRuntimeChecks>
<RuntimeLibrary>MultiThreadedDebugDLL</RuntimeLibrary>
<PrecompiledHeader>
</PrecompiledHeader>
<WarningLevel>Level3</WarningLevel>
+374
View File
@@ -0,0 +1,374 @@
<?xml version="1.0" encoding="utf-8"?>
<Project DefaultTargets="Build" ToolsVersion="15.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup Label="ProjectConfigurations">
<ProjectConfiguration Include="Debug - LLVM|x64">
<Configuration>Debug - LLVM</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
<ProjectConfiguration Include="Release - LLVM|x64">
<Configuration>Release - LLVM</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
<ProjectConfiguration Include="Release|x64">
<Configuration>Release</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
<ProjectConfiguration Include="Debug|x64">
<Configuration>Debug</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
</ItemGroup>
<PropertyGroup Label="Globals">
<ProjectGuid>{DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}</ProjectGuid>
<RootNamespace>libcurl</RootNamespace>
</PropertyGroup>
<Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<Import Project="..\common_default_macros.props" />
<PropertyGroup Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType>
<UseOfMfc>false</UseOfMfc>
<CharacterSet>Unicode</CharacterSet>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="PropertySheets">
<Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
</ImportGroup>
<PropertyGroup>
<_ProjectFileVersion>10.0.30319.1</_ProjectFileVersion>
<OutDir>$(SolutionDir)lib\$(Configuration)-$(Platform)\</OutDir>
<IntDir>$(SolutionDir)tmp\$(ProjectName)-$(Configuration)-$(Platform)\</IntDir>
</PropertyGroup>
<ItemDefinitionGroup>
<Midl>
<TargetEnvironment>X64</TargetEnvironment>
</Midl>
<ClCompile>
<Optimization>MaxSpeed</Optimization>
<InlineFunctionExpansion>OnlyExplicitInline</InlineFunctionExpansion>
<AdditionalIncludeDirectories>curl\include;curl\lib;wolfssl;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<PreprocessorDefinitions>HAVE_SNI;NDEBUG;BUILDING_LIBCURL;CURL_STATICLIB;USE_WOLFSSL;USE_IPV6;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<StringPooling>true</StringPooling>
<FunctionLevelLinking>true</FunctionLevelLinking>
<WarningLevel>Level4</WarningLevel>
</ClCompile>
<ResourceCompile>
<PreprocessorDefinitions>NDEBUG;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<Culture>0x0409</Culture>
</ResourceCompile>
<Lib>
<OutputFile>$(OutDir)$(TargetName)$(TargetExt)</OutputFile>
<TargetMachine>MachineX64</TargetMachine>
</Lib>
</ItemDefinitionGroup>
<ItemGroup>
<ClCompile Include="curl\lib\altsvc.c" />
<ClCompile Include="curl\lib\amigaos.c" />
<ClCompile Include="curl\lib\asyn-ares.c" />
<ClCompile Include="curl\lib\asyn-thread.c" />
<ClCompile Include="curl\lib\base64.c" />
<ClCompile Include="curl\lib\conncache.c" />
<ClCompile Include="curl\lib\connect.c" />
<ClCompile Include="curl\lib\content_encoding.c" />
<ClCompile Include="curl\lib\cookie.c" />
<ClCompile Include="curl\lib\curl_addrinfo.c" />
<ClCompile Include="curl\lib\curl_ctype.c" />
<ClCompile Include="curl\lib\curl_des.c" />
<ClCompile Include="curl\lib\curl_endian.c" />
<ClCompile Include="curl\lib\curl_fnmatch.c" />
<ClCompile Include="curl\lib\curl_gethostname.c" />
<ClCompile Include="curl\lib\curl_get_line.c" />
<ClCompile Include="curl\lib\curl_gssapi.c" />
<ClCompile Include="curl\lib\curl_memrchr.c" />
<ClCompile Include="curl\lib\curl_multibyte.c" />
<ClCompile Include="curl\lib\curl_ntlm_core.c" />
<ClCompile Include="curl\lib\curl_ntlm_wb.c" />
<ClCompile Include="curl\lib\curl_path.c" />
<ClCompile Include="curl\lib\curl_range.c" />
<ClCompile Include="curl\lib\curl_rtmp.c" />
<ClCompile Include="curl\lib\curl_sasl.c" />
<ClCompile Include="curl\lib\curl_sspi.c" />
<ClCompile Include="curl\lib\curl_threads.c" />
<ClCompile Include="curl\lib\dict.c" />
<ClCompile Include="curl\lib\doh.c" />
<ClCompile Include="curl\lib\dotdot.c" />
<ClCompile Include="curl\lib\easy.c" />
<ClCompile Include="curl\lib\escape.c" />
<ClCompile Include="curl\lib\file.c" />
<ClCompile Include="curl\lib\fileinfo.c" />
<ClCompile Include="curl\lib\formdata.c" />
<ClCompile Include="curl\lib\ftp.c" />
<ClCompile Include="curl\lib\ftplistparser.c" />
<ClCompile Include="curl\lib\getenv.c" />
<ClCompile Include="curl\lib\getinfo.c" />
<ClCompile Include="curl\lib\gopher.c" />
<ClCompile Include="curl\lib\hash.c" />
<ClCompile Include="curl\lib\hmac.c" />
<ClCompile Include="curl\lib\hostasyn.c" />
<ClCompile Include="curl\lib\hostcheck.c" />
<ClCompile Include="curl\lib\hostip.c" />
<ClCompile Include="curl\lib\hostip4.c" />
<ClCompile Include="curl\lib\hostip6.c" />
<ClCompile Include="curl\lib\hostsyn.c" />
<ClCompile Include="curl\lib\http.c" />
<ClCompile Include="curl\lib\http2.c" />
<ClCompile Include="curl\lib\http_chunks.c" />
<ClCompile Include="curl\lib\http_digest.c" />
<ClCompile Include="curl\lib\http_negotiate.c" />
<ClCompile Include="curl\lib\http_ntlm.c" />
<ClCompile Include="curl\lib\http_proxy.c" />
<ClCompile Include="curl\lib\idn_win32.c" />
<ClCompile Include="curl\lib\if2ip.c" />
<ClCompile Include="curl\lib\imap.c" />
<ClCompile Include="curl\lib\inet_ntop.c" />
<ClCompile Include="curl\lib\inet_pton.c" />
<ClCompile Include="curl\lib\krb5.c" />
<ClCompile Include="curl\lib\ldap.c" />
<ClCompile Include="curl\lib\llist.c" />
<ClCompile Include="curl\lib\md4.c" />
<ClCompile Include="curl\lib\md5.c" />
<ClCompile Include="curl\lib\memdebug.c" />
<ClCompile Include="curl\lib\mime.c" />
<ClCompile Include="curl\lib\mprintf.c" />
<ClCompile Include="curl\lib\multi.c" />
<ClCompile Include="curl\lib\netrc.c" />
<ClCompile Include="curl\lib\non-ascii.c" />
<ClCompile Include="curl\lib\nonblock.c" />
<ClCompile Include="curl\lib\nwlib.c" />
<ClCompile Include="curl\lib\nwos.c" />
<ClCompile Include="curl\lib\openldap.c" />
<ClCompile Include="curl\lib\parsedate.c" />
<ClCompile Include="curl\lib\pingpong.c" />
<ClCompile Include="curl\lib\pop3.c" />
<ClCompile Include="curl\lib\progress.c" />
<ClCompile Include="curl\lib\psl.c" />
<ClCompile Include="curl\lib\rand.c" />
<ClCompile Include="curl\lib\rename.c" />
<ClCompile Include="curl\lib\rtsp.c" />
<ClCompile Include="curl\lib\security.c" />
<ClCompile Include="curl\lib\select.c" />
<ClCompile Include="curl\lib\sendf.c" />
<ClCompile Include="curl\lib\setopt.c" />
<ClCompile Include="curl\lib\sha256.c" />
<ClCompile Include="curl\lib\share.c" />
<ClCompile Include="curl\lib\slist.c" />
<ClCompile Include="curl\lib\smb.c" />
<ClCompile Include="curl\lib\smtp.c" />
<ClCompile Include="curl\lib\socketpair.c" />
<ClCompile Include="curl\lib\socks.c" />
<ClCompile Include="curl\lib\socks_gssapi.c" />
<ClCompile Include="curl\lib\socks_sspi.c" />
<ClCompile Include="curl\lib\speedcheck.c" />
<ClCompile Include="curl\lib\splay.c" />
<ClCompile Include="curl\lib\strcase.c" />
<ClCompile Include="curl\lib\strdup.c" />
<ClCompile Include="curl\lib\strerror.c" />
<ClCompile Include="curl\lib\strtok.c" />
<ClCompile Include="curl\lib\strtoofft.c" />
<ClCompile Include="curl\lib\system_win32.c" />
<ClCompile Include="curl\lib\telnet.c" />
<ClCompile Include="curl\lib\tftp.c" />
<ClCompile Include="curl\lib\timeval.c" />
<ClCompile Include="curl\lib\transfer.c" />
<ClCompile Include="curl\lib\url.c" />
<ClCompile Include="curl\lib\urlapi.c" />
<ClCompile Include="curl\lib\version.c" />
<ClCompile Include="curl\lib\warnless.c" />
<ClCompile Include="curl\lib\wildcard.c" />
<ClCompile Include="curl\lib\x509asn1.c" />
<ClCompile Include="curl\lib\vauth\cleartext.c" />
<ClCompile Include="curl\lib\vauth\cram.c" />
<ClCompile Include="curl\lib\vauth\digest.c" />
<ClCompile Include="curl\lib\vauth\digest_sspi.c" />
<ClCompile Include="curl\lib\vauth\krb5_gssapi.c" />
<ClCompile Include="curl\lib\vauth\krb5_sspi.c" />
<ClCompile Include="curl\lib\vauth\ntlm.c" />
<ClCompile Include="curl\lib\vauth\ntlm_sspi.c" />
<ClCompile Include="curl\lib\vauth\oauth2.c" />
<ClCompile Include="curl\lib\vauth\spnego_gssapi.c" />
<ClCompile Include="curl\lib\vauth\spnego_sspi.c" />
<ClCompile Include="curl\lib\vauth\vauth.c" />
<ClCompile Include="curl\lib\vquic\ngtcp2.c" />
<ClCompile Include="curl\lib\vquic\quiche.c" />
<ClCompile Include="curl\lib\vssh\libssh.c" />
<ClCompile Include="curl\lib\vssh\libssh2.c" />
<ClCompile Include="curl\lib\vssh\wolfssh.c" />
<ClCompile Include="curl\lib\vtls\bearssl.c" />
<ClCompile Include="curl\lib\vtls\gskit.c" />
<ClCompile Include="curl\lib\vtls\gtls.c" />
<ClCompile Include="curl\lib\vtls\mbedtls.c" />
<ClCompile Include="curl\lib\vtls\mbedtls_threadlock.c" />
<ClCompile Include="curl\lib\vtls\mesalink.c" />
<ClCompile Include="curl\lib\vtls\nss.c" />
<ClCompile Include="curl\lib\vtls\openssl.c" />
<ClCompile Include="curl\lib\vtls\schannel.c" />
<ClCompile Include="curl\lib\vtls\schannel_verify.c" />
<ClCompile Include="curl\lib\vtls\sectransp.c" />
<ClCompile Include="curl\lib\vtls\vtls.c" />
<ClCompile Include="curl\lib\vtls\wolfssl.c" />
</ItemGroup>
<ItemGroup>
<ClInclude Include="curl\include\curl\curl.h" />
<ClInclude Include="curl\include\curl\curlver.h" />
<ClInclude Include="curl\include\curl\easy.h" />
<ClInclude Include="curl\include\curl\mprintf.h" />
<ClInclude Include="curl\include\curl\multi.h" />
<ClInclude Include="curl\include\curl\stdcheaders.h" />
<ClInclude Include="curl\include\curl\system.h" />
<ClInclude Include="curl\include\curl\typecheck-gcc.h" />
<ClInclude Include="curl\include\curl\urlapi.h" />
<ClInclude Include="curl\lib\altsvc.h" />
<ClInclude Include="curl\lib\amigaos.h" />
<ClInclude Include="curl\lib\arpa_telnet.h" />
<ClInclude Include="curl\lib\asyn.h" />
<ClInclude Include="curl\lib\config-amigaos.h" />
<ClInclude Include="curl\lib\config-dos.h" />
<ClInclude Include="curl\lib\config-mac.h" />
<ClInclude Include="curl\lib\config-os400.h" />
<ClInclude Include="curl\lib\config-plan9.h" />
<ClInclude Include="curl\lib\config-riscos.h" />
<ClInclude Include="curl\lib\config-symbian.h" />
<ClInclude Include="curl\lib\config-tpf.h" />
<ClInclude Include="curl\lib\config-vxworks.h" />
<ClInclude Include="curl\lib\config-win32.h" />
<ClInclude Include="curl\lib\config-win32ce.h" />
<ClInclude Include="curl\lib\conncache.h" />
<ClInclude Include="curl\lib\connect.h" />
<ClInclude Include="curl\lib\content_encoding.h" />
<ClInclude Include="curl\lib\cookie.h" />
<ClInclude Include="curl\lib\curlx.h" />
<ClInclude Include="curl\lib\curl_addrinfo.h" />
<ClInclude Include="curl\lib\curl_base64.h" />
<ClInclude Include="curl\lib\curl_ctype.h" />
<ClInclude Include="curl\lib\curl_des.h" />
<ClInclude Include="curl\lib\curl_endian.h" />
<ClInclude Include="curl\lib\curl_fnmatch.h" />
<ClInclude Include="curl\lib\curl_gethostname.h" />
<ClInclude Include="curl\lib\curl_get_line.h" />
<ClInclude Include="curl\lib\curl_gssapi.h" />
<ClInclude Include="curl\lib\curl_hmac.h" />
<ClInclude Include="curl\lib\curl_ldap.h" />
<ClInclude Include="curl\lib\curl_md4.h" />
<ClInclude Include="curl\lib\curl_md5.h" />
<ClInclude Include="curl\lib\curl_memory.h" />
<ClInclude Include="curl\lib\curl_memrchr.h" />
<ClInclude Include="curl\lib\curl_multibyte.h" />
<ClInclude Include="curl\lib\curl_ntlm_core.h" />
<ClInclude Include="curl\lib\curl_ntlm_wb.h" />
<ClInclude Include="curl\lib\curl_path.h" />
<ClInclude Include="curl\lib\curl_printf.h" />
<ClInclude Include="curl\lib\curl_range.h" />
<ClInclude Include="curl\lib\curl_rtmp.h" />
<ClInclude Include="curl\lib\curl_sasl.h" />
<ClInclude Include="curl\lib\curl_sec.h" />
<ClInclude Include="curl\lib\curl_setup.h" />
<ClInclude Include="curl\lib\curl_setup_once.h" />
<ClInclude Include="curl\lib\curl_sha256.h" />
<ClInclude Include="curl\lib\curl_sspi.h" />
<ClInclude Include="curl\lib\curl_threads.h" />
<ClInclude Include="curl\lib\dict.h" />
<ClInclude Include="curl\lib\doh.h" />
<ClInclude Include="curl\lib\dotdot.h" />
<ClInclude Include="curl\lib\easyif.h" />
<ClInclude Include="curl\lib\escape.h" />
<ClInclude Include="curl\lib\file.h" />
<ClInclude Include="curl\lib\fileinfo.h" />
<ClInclude Include="curl\lib\formdata.h" />
<ClInclude Include="curl\lib\ftp.h" />
<ClInclude Include="curl\lib\ftplistparser.h" />
<ClInclude Include="curl\lib\getinfo.h" />
<ClInclude Include="curl\lib\gopher.h" />
<ClInclude Include="curl\lib\hash.h" />
<ClInclude Include="curl\lib\hostcheck.h" />
<ClInclude Include="curl\lib\hostip.h" />
<ClInclude Include="curl\lib\http.h" />
<ClInclude Include="curl\lib\http2.h" />
<ClInclude Include="curl\lib\http_chunks.h" />
<ClInclude Include="curl\lib\http_digest.h" />
<ClInclude Include="curl\lib\http_negotiate.h" />
<ClInclude Include="curl\lib\http_ntlm.h" />
<ClInclude Include="curl\lib\http_proxy.h" />
<ClInclude Include="curl\lib\if2ip.h" />
<ClInclude Include="curl\lib\imap.h" />
<ClInclude Include="curl\lib\inet_ntop.h" />
<ClInclude Include="curl\lib\inet_pton.h" />
<ClInclude Include="curl\lib\llist.h" />
<ClInclude Include="curl\lib\memdebug.h" />
<ClInclude Include="curl\lib\mime.h" />
<ClInclude Include="curl\lib\multihandle.h" />
<ClInclude Include="curl\lib\multiif.h" />
<ClInclude Include="curl\lib\netrc.h" />
<ClInclude Include="curl\lib\non-ascii.h" />
<ClInclude Include="curl\lib\nonblock.h" />
<ClInclude Include="curl\lib\parsedate.h" />
<ClInclude Include="curl\lib\pingpong.h" />
<ClInclude Include="curl\lib\pop3.h" />
<ClInclude Include="curl\lib\progress.h" />
<ClInclude Include="curl\lib\psl.h" />
<ClInclude Include="curl\lib\quic.h" />
<ClInclude Include="curl\lib\rand.h" />
<ClInclude Include="curl\lib\rename.h" />
<ClInclude Include="curl\lib\rtsp.h" />
<ClInclude Include="curl\lib\select.h" />
<ClInclude Include="curl\lib\sendf.h" />
<ClInclude Include="curl\lib\setopt.h" />
<ClInclude Include="curl\lib\setup-os400.h" />
<ClInclude Include="curl\lib\setup-vms.h" />
<ClInclude Include="curl\lib\share.h" />
<ClInclude Include="curl\lib\sigpipe.h" />
<ClInclude Include="curl\lib\slist.h" />
<ClInclude Include="curl\lib\smb.h" />
<ClInclude Include="curl\lib\smtp.h" />
<ClInclude Include="curl\lib\sockaddr.h" />
<ClInclude Include="curl\lib\socketpair.h" />
<ClInclude Include="curl\lib\socks.h" />
<ClInclude Include="curl\lib\speedcheck.h" />
<ClInclude Include="curl\lib\splay.h" />
<ClInclude Include="curl\lib\strcase.h" />
<ClInclude Include="curl\lib\strdup.h" />
<ClInclude Include="curl\lib\strerror.h" />
<ClInclude Include="curl\lib\strtok.h" />
<ClInclude Include="curl\lib\strtoofft.h" />
<ClInclude Include="curl\lib\system_win32.h" />
<ClInclude Include="curl\lib\telnet.h" />
<ClInclude Include="curl\lib\tftp.h" />
<ClInclude Include="curl\lib\timeval.h" />
<ClInclude Include="curl\lib\transfer.h" />
<ClInclude Include="curl\lib\url.h" />
<ClInclude Include="curl\lib\urlapi-int.h" />
<ClInclude Include="curl\lib\urldata.h" />
<ClInclude Include="curl\lib\warnless.h" />
<ClInclude Include="curl\lib\wildcard.h" />
<ClInclude Include="curl\lib\x509asn1.h" />
<ClInclude Include="curl\lib\vauth\digest.h" />
<ClInclude Include="curl\lib\vauth\ntlm.h" />
<ClInclude Include="curl\lib\vauth\vauth.h" />
<ClInclude Include="curl\lib\vquic\ngtcp2.h" />
<ClInclude Include="curl\lib\vquic\quiche.h" />
<ClInclude Include="curl\lib\vssh\ssh.h" />
<ClInclude Include="curl\lib\vssh\wolfssh.h" />
<ClInclude Include="curl\lib\vtls\bearssl.h" />
<ClInclude Include="curl\lib\vtls\gskit.h" />
<ClInclude Include="curl\lib\vtls\gtls.h" />
<ClInclude Include="curl\lib\vtls\mbedtls.h" />
<ClInclude Include="curl\lib\vtls\mbedtls_threadlock.h" />
<ClInclude Include="curl\lib\vtls\mesalink.h" />
<ClInclude Include="curl\lib\vtls\nssg.h" />
<ClInclude Include="curl\lib\vtls\openssl.h" />
<ClInclude Include="curl\lib\vtls\schannel.h" />
<ClInclude Include="curl\lib\vtls\sectransp.h" />
<ClInclude Include="curl\lib\vtls\vtls.h" />
<ClInclude Include="curl\lib\vtls\wolfssl.h" />
</ItemGroup>
<ItemGroup>
<ResourceCompile Include="curl\lib\libcurl.rc" />
</ItemGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />
<ImportGroup Label="ExtensionTargets">
</ImportGroup>
</Project>
+911
View File
@@ -0,0 +1,911 @@
<?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup>
<Filter Include="Source Files">
<UniqueIdentifier>{4FC737F1-C7A5-4376-A066-2A32D752A2FF}</UniqueIdentifier>
<Extensions>cpp;c;cc;cxx;def;odl;idl;hpj;bat;asm;asmx</Extensions>
</Filter>
<Filter Include="Header Files">
<UniqueIdentifier>{93995380-89BD-4b04-88EB-625FBE52EBFB}</UniqueIdentifier>
<Extensions>h;hh;hpp;hxx;hm;inl;inc;xsd</Extensions>
</Filter>
<Filter Include="Resource Files">
<UniqueIdentifier>{67DA6AB6-F800-4c08-8B7A-83BB121AAD01}</UniqueIdentifier>
<Extensions>rc;ico;cur;bmp;dlg;rc2;rct;bin;rgs;gif;jpg;jpeg;jpe;resx;tiff;tif;png;wav;mfcribbon-ms</Extensions>
</Filter>
</ItemGroup>
<ItemGroup>
<ClCompile Include="curl\lib\altsvc.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\amigaos.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\asyn-ares.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\asyn-thread.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\base64.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\conncache.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\connect.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\content_encoding.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\cookie.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_addrinfo.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_ctype.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_des.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_endian.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_fnmatch.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_gethostname.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_get_line.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_gssapi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_memrchr.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_multibyte.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_ntlm_core.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_ntlm_wb.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_path.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_range.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_rtmp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_sasl.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\curl_threads.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\dict.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\doh.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\dotdot.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\easy.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\escape.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\file.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\fileinfo.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\formdata.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\ftp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\ftplistparser.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\getenv.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\getinfo.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\gopher.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hash.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hmac.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostasyn.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostcheck.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostip.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostip4.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostip6.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\hostsyn.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http2.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http_chunks.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http_digest.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http_negotiate.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http_ntlm.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\http_proxy.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\idn_win32.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\if2ip.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\imap.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\inet_ntop.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\inet_pton.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\krb5.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\ldap.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\llist.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\md4.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\md5.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\memdebug.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\mime.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\mprintf.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\multi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\netrc.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\non-ascii.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\nonblock.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\nwlib.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\nwos.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\openldap.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\parsedate.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\pingpong.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\pop3.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\progress.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\psl.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\rand.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\rename.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\rtsp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\security.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\select.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\sendf.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\setopt.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\sha256.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\share.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\slist.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\smb.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\smtp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\socketpair.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\socks.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\socks_gssapi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\socks_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\speedcheck.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\splay.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\strcase.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\strdup.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\strerror.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\strtok.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\strtoofft.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\system_win32.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\telnet.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\tftp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\timeval.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\transfer.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\url.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\urlapi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\version.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\warnless.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\wildcard.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\x509asn1.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\cleartext.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\cram.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\digest.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\digest_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\krb5_gssapi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\krb5_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\ntlm.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\ntlm_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\oauth2.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\spnego_gssapi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\spnego_sspi.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vauth\vauth.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vquic\ngtcp2.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vquic\quiche.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vssh\libssh.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vssh\libssh2.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vssh\wolfssh.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\bearssl.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\gskit.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\gtls.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\mbedtls.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\mbedtls_threadlock.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\mesalink.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\nss.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\openssl.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\schannel.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\schannel_verify.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\sectransp.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\vtls.c">
<Filter>Source Files</Filter>
</ClCompile>
<ClCompile Include="curl\lib\vtls\wolfssl.c">
<Filter>Source Files</Filter>
</ClCompile>
</ItemGroup>
<ItemGroup>
<ClInclude Include="curl\include\curl\curl.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\curlver.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\easy.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\mprintf.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\multi.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\stdcheaders.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\system.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\typecheck-gcc.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\include\curl\urlapi.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\altsvc.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\amigaos.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\arpa_telnet.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\asyn.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-amigaos.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-dos.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-mac.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-os400.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-plan9.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-riscos.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-symbian.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-tpf.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-vxworks.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-win32.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\config-win32ce.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\conncache.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\connect.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\content_encoding.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\cookie.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curlx.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_addrinfo.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_base64.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_ctype.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_des.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_endian.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_fnmatch.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_gethostname.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_get_line.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_gssapi.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_hmac.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_ldap.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_md4.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_md5.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_memory.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_memrchr.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_multibyte.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_ntlm_core.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_ntlm_wb.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_path.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_printf.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_range.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_rtmp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_sasl.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_sec.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_setup.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_setup_once.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_sha256.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_sspi.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\curl_threads.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\dict.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\doh.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\dotdot.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\easyif.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\escape.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\file.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\fileinfo.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\formdata.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\ftp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\ftplistparser.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\getinfo.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\gopher.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\hash.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\hostcheck.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\hostip.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http2.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http_chunks.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http_digest.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http_negotiate.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http_ntlm.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\http_proxy.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\if2ip.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\imap.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\inet_ntop.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\inet_pton.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\llist.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\memdebug.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\mime.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\multihandle.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\multiif.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\netrc.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\non-ascii.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\nonblock.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\parsedate.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\pingpong.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\pop3.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\progress.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\psl.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\quic.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\rand.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\rename.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\rtsp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\select.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\sendf.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\setopt.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\setup-os400.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\setup-vms.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\share.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\sigpipe.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\slist.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\smb.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\smtp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\sockaddr.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\socketpair.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\socks.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\speedcheck.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\splay.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\strcase.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\strdup.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\strerror.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\strtok.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\strtoofft.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\system_win32.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\telnet.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\tftp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\timeval.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\transfer.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\url.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\urlapi-int.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\urldata.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\warnless.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\wildcard.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\x509asn1.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vauth\digest.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vauth\ntlm.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vauth\vauth.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vquic\ngtcp2.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vquic\quiche.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vssh\ssh.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vssh\wolfssh.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\bearssl.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\gskit.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\gtls.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\mbedtls.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\mbedtls_threadlock.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\mesalink.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\nssg.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\openssl.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\schannel.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\sectransp.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\vtls.h">
<Filter>Header Files</Filter>
</ClInclude>
<ClInclude Include="curl\lib\vtls\wolfssl.h">
<Filter>Header Files</Filter>
</ClInclude>
</ItemGroup>
<ItemGroup>
<ResourceCompile Include="curl\lib\libcurl.rc">
<Filter>Resource Files</Filter>
</ResourceCompile>
</ItemGroup>
</Project>
+4 -1
View File
@@ -28,6 +28,9 @@
<CharacterSet>MultiByte</CharacterSet>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug Library|x64'" Label="PropertySheets">
@@ -97,7 +100,7 @@
<DisableSpecificWarnings>$(DisableSpecificWarnings)</DisableSpecificWarnings>
<AdditionalIncludeDirectories>$(ZLibSrcDir);%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<TreatWarningAsError>$(TreatWarningAsError)</TreatWarningAsError>
<Optimization>Full</Optimization>
<Optimization>MaxSpeed</Optimization>
<WholeProgramOptimization>true</WholeProgramOptimization>
</ClCompile>
<Link>
+25
View File
@@ -0,0 +1,25 @@
cmake_minimum_required(VERSION 2.8.4)
list(APPEND CMAKE_MODULE_PATH "${CMAKE_CURRENT_SOURCE_DIR}/cmake/modules")
set(LIBUSB_SOURCE_DIR ${CMAKE_CURRENT_SOURCE_DIR}/../libusb/)
project(libusb)
option(WITH_DEBUG_LOG "enable debug logging" OFF)
# if debug logging is enabled, by default enable logging
option(WITH_LOGGING "if false, disable all logging" ON)
option(WITHOUT_PTHREADS "force pthreads to not be used. if on, then they are used based on detection logic" OFF)
set(LIBUSB_MAJOR 1)
set(LIBUSB_MINOR 0)
set(LIBUSB_MICRO 23)
macro(append_compiler_flags)
foreach(FLAG IN ITEMS ${ARGN})
set(CMAKE_C_FLAGS "${CMAKE_C_FLAGS} ${FLAG}")
set(CMAKE_CXX_FLAGS "${CMAKE_CXX_FLAGS} ${FLAG}")
endforeach()
endmacro()
include(libusb.cmake)
@@ -0,0 +1,17 @@
# CoreFoundation_INCLUDE_DIR
# CoreFoundation_LIBRARIES
# CoreFoundation_FOUND
include(LibFindMacros)
find_path(CoreFoundation_INCLUDE_DIR
CoreFoundation.h
PATH_SUFFIXES CoreFoundation
)
find_library(CoreFoundation_LIBRARY
NAMES CoreFoundation
)
set(CoreFoundation_PROCESS_INCLUDES CoreFoundation_INCLUDE_DIR)
set(CoreFoundation_PROCESS_LIBS CoreFoundation_LIBRARY)
libfind_process(CoreFoundation)
+20
View File
@@ -0,0 +1,20 @@
# IOKit_INCLUDE_DIR
# IOKit_LIBRARIES
# IOKit_FOUND
include(LibFindMacros)
# IOKit depends on CoreFoundation
find_package(CoreFoundation REQUIRED)
find_path(IOKit_INCLUDE_DIR
IOKitLib.h
PATH_SUFFIXES IOKit
)
find_library(IOKit_LIBRARY
NAMES IOKit
)
set(IOKit_PROCESS_INCLUDES IOKit_INCLUDE_DIR CoreFoundation_INCLUDE_DIR)
set(IOKit_PROCESS_LIBS IOKit_LIBRARY CoreFoundation_LIBRARIES)
libfind_process(IOKit)
+99
View File
@@ -0,0 +1,99 @@
# Works the same as find_package, but forwards the "REQUIRED" and "QUIET" arguments
# used for the current package. For this to work, the first parameter must be the
# prefix of the current package, then the prefix of the new package etc, which are
# passed to find_package.
macro (libfind_package PREFIX)
set (LIBFIND_PACKAGE_ARGS ${ARGN})
if (${PREFIX}_FIND_QUIETLY)
set (LIBFIND_PACKAGE_ARGS ${LIBFIND_PACKAGE_ARGS} QUIET)
endif (${PREFIX}_FIND_QUIETLY)
if (${PREFIX}_FIND_REQUIRED)
set (LIBFIND_PACKAGE_ARGS ${LIBFIND_PACKAGE_ARGS} REQUIRED)
endif (${PREFIX}_FIND_REQUIRED)
find_package(${LIBFIND_PACKAGE_ARGS})
endmacro (libfind_package)
# CMake developers made the UsePkgConfig system deprecated in the same release (2.6)
# where they added pkg_check_modules. Consequently I need to support both in my scripts
# to avoid those deprecated warnings. Here's a helper that does just that.
# Works identically to pkg_check_modules, except that no checks are needed prior to use.
macro (libfind_pkg_check_modules PREFIX PKGNAME)
if (${CMAKE_MAJOR_VERSION} EQUAL 2 AND ${CMAKE_MINOR_VERSION} EQUAL 4)
include(UsePkgConfig)
pkgconfig(${PKGNAME} ${PREFIX}_INCLUDE_DIRS ${PREFIX}_LIBRARY_DIRS ${PREFIX}_LDFLAGS ${PREFIX}_CFLAGS)
else (${CMAKE_MAJOR_VERSION} EQUAL 2 AND ${CMAKE_MINOR_VERSION} EQUAL 4)
find_package(PkgConfig)
if (PKG_CONFIG_FOUND)
pkg_check_modules(${PREFIX} ${PKGNAME})
endif (PKG_CONFIG_FOUND)
endif (${CMAKE_MAJOR_VERSION} EQUAL 2 AND ${CMAKE_MINOR_VERSION} EQUAL 4)
endmacro (libfind_pkg_check_modules)
# Do the final processing once the paths have been detected.
# If include dirs are needed, ${PREFIX}_PROCESS_INCLUDES should be set to contain
# all the variables, each of which contain one include directory.
# Ditto for ${PREFIX}_PROCESS_LIBS and library files.
# Will set ${PREFIX}_FOUND, ${PREFIX}_INCLUDE_DIRS and ${PREFIX}_LIBRARIES.
# Also handles errors in case library detection was required, etc.
macro (libfind_process PREFIX)
# Skip processing if already processed during this run
if (NOT ${PREFIX}_FOUND)
# Start with the assumption that the library was found
set (${PREFIX}_FOUND TRUE)
# Process all includes and set _FOUND to false if any are missing
foreach (i ${${PREFIX}_PROCESS_INCLUDES})
if (${i})
set (${PREFIX}_INCLUDE_DIRS ${${PREFIX}_INCLUDE_DIRS} ${${i}})
mark_as_advanced(${i})
else (${i})
set (${PREFIX}_FOUND FALSE)
endif (${i})
endforeach (i)
# Process all libraries and set _FOUND to false if any are missing
foreach (i ${${PREFIX}_PROCESS_LIBS})
if (${i})
set (${PREFIX}_LIBRARIES ${${PREFIX}_LIBRARIES} ${${i}})
mark_as_advanced(${i})
else (${i})
set (${PREFIX}_FOUND FALSE)
endif (${i})
endforeach (i)
# Print message and/or exit on fatal error
if (${PREFIX}_FOUND)
if (NOT ${PREFIX}_FIND_QUIETLY)
message (STATUS "Found ${PREFIX} ${${PREFIX}_VERSION}")
endif (NOT ${PREFIX}_FIND_QUIETLY)
else (${PREFIX}_FOUND)
if (${PREFIX}_FIND_REQUIRED)
foreach (i ${${PREFIX}_PROCESS_INCLUDES} ${${PREFIX}_PROCESS_LIBS})
message("${i}=${${i}}")
endforeach (i)
message (FATAL_ERROR "Required library ${PREFIX} NOT FOUND.\nInstall the library (dev version) and try again. If the library is already installed, use ccmake to set the missing variables manually.")
endif (${PREFIX}_FIND_REQUIRED)
endif (${PREFIX}_FOUND)
endif (NOT ${PREFIX}_FOUND)
endmacro (libfind_process)
macro(libfind_library PREFIX basename)
set(TMP "")
if(MSVC80)
set(TMP -vc80)
endif(MSVC80)
if(MSVC90)
set(TMP -vc90)
endif(MSVC90)
set(${PREFIX}_LIBNAMES ${basename}${TMP})
if(${ARGC} GREATER 2)
set(${PREFIX}_LIBNAMES ${basename}${TMP}-${ARGV2})
string(REGEX REPLACE "\\." "_" TMP ${${PREFIX}_LIBNAMES})
set(${PREFIX}_LIBNAMES ${${PREFIX}_LIBNAMES} ${TMP})
endif(${ARGC} GREATER 2)
find_library(${PREFIX}_LIBRARY
NAMES ${${PREFIX}_LIBNAMES}
PATHS ${${PREFIX}_PKGCONF_LIBRARY_DIRS}
)
endmacro(libfind_library)
+96
View File
@@ -0,0 +1,96 @@
include(CheckCXXCompilerFlag)
include(CheckIncludeFiles)
include(CheckTypeSize)
if (CMAKE_COMPILER_IS_GNUCC OR CMAKE_COMPILER_IS_GNUCXX)
if (NOT OS_WINDOWS)
# mingw appears to print a bunch of warnings about this
check_cxx_compiler_flag("-fvisibility=hidden" HAVE_VISIBILITY)
endif()
check_cxx_compiler_flag("-Wno-pointer-sign" HAVE_WARN_NO_POINTER_SIGN)
set(_GNU_SOURCE 1 CACHE INTERNAL "" FORCE)
unset(ADDITIONAL_CC_FLAGS)
if (HAVE_VISIBILITY)
list(APPEND ADDITIONAL_CC_FLAGS -fvisibility=hidden)
endif()
if (HAVE_WARN_NO_POINTER_SIGN)
list(APPEND ADDITIONAL_CC_FLAGS -Wno-pointer-sign)
endif()
append_compiler_flags(
-std=gnu99
-Wall
-Wundef
-Wunused
-Wstrict-prototypes
-Werror-implicit-function-declaration
-Wshadow
${ADDITIONAL_CC_FLAGS}
)
elseif(MSVC)
add_definitions(-D_CRT_SECURE_NO_WARNINGS)
endif()
check_include_files(sys/timerfd.h USBI_TIMERFD_AVAILABLE)
#check_type_size(struct timespec STRUCT_TIMESPEC)
if (HAVE_VISIBILITY)
set(DEFAULT_VISIBILITY "__attribute__((visibility(\"default\")))" CACHE INTERNAL "visibility attribute to function decl" FORCE)
else()
set(DEFAULT_VISIBILITY "" CACHE INTERNAL "visibility attribute to function decl" FORCE)
endif()
if (NOT WITHOUT_POLL_H)
check_include_files(poll.h HAVE_POLL_H)
else()
set(HAVE_POLL_H FALSE CACHE INTERNAL "poll.h explicitely disabled" FORCE)
endif()
if (HAVE_POLL_H)
list(APPEND CMAKE_EXTRA_INCLUDE_FILES "poll.h")
check_type_size(nfds_t NFDS_T)
unset(CMAKE_EXTRA_INCLUDE_FILES)
else()
set(HAVE_NFDS_T FALSE CACHE INTERNAL "poll.h not found - assuming no nfds_t (windows)" FORCE)
set(NFDS_T "" CACHE INTERNAL "" FORCE)
endif()
if (HAVE_NFDS_T)
set(POLL_NFDS_TYPE nfds_t CACHE INTERNAL "the poll nfds types for this platform" FORCE)
else()
set(POLL_NFDS_TYPE "unsigned int" CACHE INTERNAL "the poll nfds for this platform" FORCE)
endif()
if (OS_WINDOWS)
macro(copy_header_if_missing HEADER VARIABLE ALTERNATIVE_DIR)
check_include_files(${HEADER} ${VARIABLE})
if (NOT ${VARIABLE})
message(STATUS "Missing ${HEADER} - grabbing from ${ALTERNATIVE_DIR}")
file(COPY "${ALTERNATIVE_DIR}/${HEADER}" DESTINATION "${CMAKE_CURRENT_BINARY_DIR}/")
endif()
endmacro()
# Only VS 2010 has stdint.h
copy_header_if_missing(stdint.h HAVE_STDINT_H ../msvc)
copy_header_if_missing(inttypes.h HAVE_INTTYPES_H ../msvc)
endif()
set(ENABLE_DEBUG_LOGGING ${WITH_DEBUG_LOG} CACHE INTERNAL "enable debug logging (WITH_DEBUG_LOGGING)" FORCE)
set(ENABLE_LOGGING ${WITH_LOGGING} CACHE INTERNAL "enable logging (WITH_LOGGING)" FORCE)
set(PACKAGE "libusb" CACHE INTERNAL "The package name" FORCE)
set(PACKAGE_BUGREPORT "libusb-devel@lists.sourceforge.net" CACHE INTERNAL "Where to send bug reports" FORCE)
set(PACKAGE_VERSION "${LIBUSB_MAJOR}.${LIBUSB_MINOR}.${LIBUSB_MICRO}" CACHE INTERNAL "package version" FORCE)
set(PACKAGE_STRING "${PACKAGE} ${PACKAGE_VERSION}" CACHE INTERNAL "package string" FORCE)
set(PACKAGE_URL "http://www.libusb.org" CACHE INTERNAL "package url" FORCE)
set(PACKAGE_TARNAME "libusb" CACHE INTERNAL "tarball name" FORCE)
set(VERSION "${PACKAGE_VERSION}" CACHE INTERNAL "version" FORCE)
configure_file(config.h.cmake ${CMAKE_CURRENT_BINARY_DIR}/config.h @ONLY)
message(STATUS "Generated configuration file in ${CMAKE_CURRENT_BINARY_DIR}/config.h")
# for generated config.h
include_directories(${CMAKE_CURRENT_BINARY_DIR})
+37
View File
@@ -0,0 +1,37 @@
#ifndef LIBUSB_CONFIG_H
#define LIBUSB_CONFIG_H
#define DEFAULT_VISIBILITY @DEFAULT_VISIBILITY@
#cmakedefine ENABLE_DEBUG_LOGGING
#cmakedefine ENABLE_LOGGING
#define LIBUSB_MAJOR @LIBUSB_MAJOR@
#define LIBUSB_MINOR @LIBUSB_MINOR@
#define LIBUSB_MICRO @LIBUSB_MINOR@
#define _GNU_SOURCE 1
#define PACKAGE @PACKAGE@
#define PACKAGE_BUGREPORT @PACKAGE_BUGREPORT@
#define PACKAGE_STRING @PACKAGE_STRING@
#define PACKAGE_URL @PACKAGE_URL@
#define PACKAGE_VERSION @PACKAGE_VERSION@
#define PACKAGE_TARNAME @PACKAGE_TARNAME@
#define VERSION @VERSION@
#cmakedefine OS_LINUX
#cmakedefine OS_DARWIN
#cmakedefine OS_WINDOWS
#cmakedefine THREADS_POSIX
#cmakedefine USBI_TIMERFD_AVAILABLE
#cmakedefine HAVE_STRUCT_TIMESPEC
#cmakedefine HAVE_POLL_H
#cmakedefine HAVE_SYS_TIME_H
#define POLL_NFDS_TYPE @POLL_NFDS_TYPE@
#endif /* LIBUSB_CONFIG_H */
+11
View File
@@ -0,0 +1,11 @@
prefix=@CMAKE_INSTALL_PREFIX@
libdir=@CMAKE_INSTALL_PREFIX@/lib@
includedir=@CMAKE_INSTALL_PREFIX@/include@
Name: libusb-1.0
Description: C API for USB device access from Linux, Mac OS X and Windows userspace
Version: @VERSION@
Libs: -L${libdir} -lusb-1.0
Libs.private: @LIBUSB_LIB_DEPENDS@
Cflags: -I${includedir}/libusb-1.0
+76
View File
@@ -0,0 +1,76 @@
include(os.cmake)
include(config.cmake)
include(FindThreads)
set (LIBUSB_COMMON
core.c
descriptor.c
io.c
sync.c
hotplug.c
strerror.c
libusb-1.0.rc
libusb-1.0.def
)
foreach(SRC IN LISTS LIBUSB_COMMON)
list(APPEND LIBUSB_COMMON_FINAL ${LIBUSB_SOURCE_DIR}/libusb/${SRC})
endforeach()
include_directories(${LIBUSB_SOURCE_DIR}/libusb)
include_directories(${LIBUSB_SOURCE_DIR}/libusb/os)
if (CMAKE_THREAD_LIBS_INIT)
list(APPEND LIBUSB_LIBRARIES ${CMAKE_THREAD_LIBS_INIT})
endif()
add_library(usb-1.0-static
STATIC
${LIBUSB_COMMON_FINAL}
${LIBUSB_PLATFORM}
)
target_include_directories(usb-1.0-static PUBLIC $<BUILD_INTERFACE:${LIBUSB_SOURCE_DIR}/libusb>)
set_target_properties(usb-1.0-static PROPERTIES
PREFIX "lib"
OUTPUT_NAME "usb-1.0"
CLEAN_DIRECT_OUTPUT 1
PUBLIC_HEADER libusb.h
VERSION "${LIBUSB_MAJOR}.${LIBUSB_MINOR}.${LIBUSB_MICRO}"
SOVERSION "${LIBUSB_MAJOR}.${LIBUSB_MINOR}.${LIBUSB_MICRO}"
)
if (DEFINED LIBUSB_LIBRARIES)
target_link_libraries(usb-1.0-static
${LIBUSB_LIBRARIES}
)
endif()
list(APPEND LIBUSB_LIBTARGETS usb-1.0-static)
install(TARGETS ${LIBUSB_LIBTARGETS} EXPORT libusb-1
PUBLIC_HEADER DESTINATION include/libusb-1.0
ARCHIVE DESTINATION lib
LIBRARY DESTINATION lib
RUNTIME DESTINATION lib
)
install(EXPORT libusb-1 DESTINATION lib/libusb)
foreach(LIB IN LISTS LIBUSB_LIBRARIES)
if (LIB MATCHES .framework$)
get_filename_component(LIB "${LIB}" NAME)
set(LIB "-Wl,-framework,${LIB}")
elseif (LIB MATCHES .dylib$)
get_filename_component(LIBDIR "${LIB}" PATH)
get_filename_component(LIB "${LIB}" NAME)
string(REGEX REPLACE "lib(.*).dylib$" "\\1" LIB "${LIB}")
set(LIB "-L${LIBDIR} -l${LIB}")
endif()
set(LIBUSB_LIB_DEPENDS "${LIBUSB_LIB_DEPENDS} ${LIB}")
endforeach()
configure_file(libusb-1.0.pc.cmake "${CMAKE_CURRENT_BINARY_DIR}/libusb-1.0.pc" @ONLY)
install(FILES "${CMAKE_CURRENT_BINARY_DIR}/libusb-1.0.pc" DESTINATION lib/pkgconfig)
+107
View File
@@ -0,0 +1,107 @@
include(FindThreads)
set(PTHREADS_ENABLED FALSE)
if (CMAKE_USE_PTHREADS_INIT)
set(PTHREADS_ENABLED TRUE)
endif()
if (WIN32 OR "${CMAKE_SYSTEM_NAME}" STREQUAL "CYGWIN")
set(OS_WINDOWS 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
# Enable MingW support for RC language (for CMake pre-2.8)
if (MINGW)
set(CMAKE_RC_COMPILER_INIT windres)
set(CMAKE_RC_COMPILE_OBJECT "<CMAKE_RC_COMPILER> <FLAGS> -O coff <DEFINES> -i <SOURCE> -o <OBJECT>")
endif()
enable_language(RC)
if ("${CMAKE_SYSTEM_NAME}" STREQUAL "CYGWIN")
message(STATUS "Detected cygwin")
set(PTHREADS_ENABLED TRUE)
set(WITHOUT_POLL_H TRUE CACHE INTERNAL "Disable using poll.h even if it's available - use windows poll instead fo cygwin's" FORCE)
endif()
list(APPEND PLATFORM_SRC
poll_windows.c
windows_usbdk.c
windows_nt_common.c
windows_winusb.c
threads_windows.c
)
if (PTHREADS_ENABLED AND NOT WITHOUT_PTHREADS)
list(APPEND PLATFORM_SRC threads_posix)
else()
list(APPEND PLATFORM_SRC threads_windows.c)
endif()
elseif (APPLE)
# Apple != OSX alone
set(OS_DARWIN 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
if ("${CMAKE_SYSTEM_NAME}" STREQUAL "Darwin")
set(PLATFORM_SRC
darwin_usb.c
threads_posix.c
poll_posix.c
)
find_package(IOKit REQUIRED)
list(APPEND LIBUSB_LIBRARIES ${IOKit_LIBRARIES})
# Currently only objc_registerThreadWithCollector requires linking against it
# which is only for MAC_OS_X_VERSION_MIN_REQUIRED >= 1060
include(CheckCSourceCompiles)
check_c_source_compiles(
"#include <AvailabilityMacros.h>
int main()
{
#if !(MAC_OS_X_VERSION_MIN_REQUIRED >= 1060)
#error \"Don't need objc\"
#endif
}
" NEED_OBJC_REGISTER_THREAD_WITH_COLLECTOR)
if (NEED_OBJC_REGISTER_THREAD_WITH_COLLECTOR)
find_library(LIBOBJC objc)
if (NOT LIBOBJC)
message(SEND_ERROR "Need objc library but can't find it")
else()
list(APPEND LIBUSB_LIBRARIES ${LIBOBJC})
endif()
endif()
endif()
elseif (UNIX)
# Unix is for all *NIX systems including OSX
if ("${CMAKE_SYSTEM_NAME}" STREQUAL "Linux")
set(OS_LINUX 1 CACHE INTERNAL "controls config.h macro definition" FORCE)
set(PLATFORM_SRC
linux_usbfs.c
linux_netlink.c
threads_posix.c
poll_posix.c
)
list(APPEND LIBUSB_LIBRARIES rt)
endif()
endif()
if (NOT PLATFORM_SRC)
message(FATAL_ERROR "Unsupported platform ${CMAKE_SYSTEM_NAME}. Currently only support Windows, OSX, & Linux.")
endif()
# the paths are relative to this directory but used in the parent directory,
# so we have to adjust the paths
foreach(SRC IN LISTS PLATFORM_SRC)
list(APPEND LIBUSB_PLATFORM ${LIBUSB_SOURCE_DIR}/libusb/os/${SRC})
endforeach()
# export one level up so that the generic
# libusb parts know what the platform bits are supposed to be
set(LIBUSB_PLATFORM ${LIBUSB_PLATFORM} PARENT_SCOPE)
set(LIBUSB_LIBRARIES ${LIBUSB_LIBRARIES} PARENT_SCOPE)
if (WITHOUT_PTHREADS)
set(PTHREADS_ENABLED FALSE)
endif()
set(THREADS_POSIX ${PTHREADS_ENABLED} CACHE INTERNAL "use pthreads" FORCE)
+3
View File
@@ -24,6 +24,9 @@
<WholeProgramOptimization Condition="'$(Configuration)'=='Release'">true</WholeProgramOptimization>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="PropertySheets">
+5 -5
View File
@@ -12,7 +12,7 @@ if(WITH_LLVM)
option(LLVM_INCLUDE_TOOLS OFF)
option(LLVM_INCLUDE_UTILS OFF)
option(WITH_POLLY OFF)
option(LLVM_ENABLE_CXX1Z TRUE)
option(LLVM_CCACHE_BUILD ON)
set(CXX_FLAGS_OLD ${CMAKE_CXX_FLAGS})
@@ -27,7 +27,7 @@ if(WITH_LLVM)
set(CMAKE_CXX_FLAGS ${CXX_FLAGS_OLD})
# now tries to find LLVM again
find_package(LLVM 10.0 CONFIG)
find_package(LLVM 11.0 CONFIG)
if(NOT LLVM_FOUND)
message(FATAL_ERROR "Couldn't build LLVM from the submodule. You might need to run `git submodule update --init`")
endif()
@@ -40,11 +40,11 @@ if(WITH_LLVM)
set(LLVM_DIR ${CMAKE_SOURCE_DIR}/${LLVM_DIR})
endif()
find_package(LLVM 10.0 CONFIG)
find_package(LLVM 11.0 CONFIG)
if (NOT LLVM_FOUND)
if (LLVM_VERSION AND LLVM_VERSION_MAJOR LESS 9)
message(FATAL_ERROR "Found LLVM version ${LLVM_VERSION}. Required version 9.0. \
if (LLVM_VERSION AND LLVM_VERSION_MAJOR LESS 11)
message(FATAL_ERROR "Found LLVM version ${LLVM_VERSION}. Required version 11.0. \
Enable BUILD_LLVM_SUBMODULE option to build LLVM from included as a git submodule.")
endif()
+3
View File
@@ -21,6 +21,9 @@
</PropertyGroup>
<Import Project="$(SolutionDir)\3rdparty\zlib.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
+12 -12
View File
@@ -1,30 +1,30 @@
add_library(3rdparty_qt5 INTERFACE)
find_package(Qt5 5.11 CONFIG COMPONENTS Widgets Network Qml Concurrent)
find_package(Qt5 5.14 CONFIG COMPONENTS Widgets Concurrent)
if(WIN32)
find_package(Qt5 5.11 COMPONENTS WinExtras REQUIRED)
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::WinExtras Qt5::Network Qt5::Qml Qt5::Concurrent)
find_package(Qt5 5.14 COMPONENTS WinExtras REQUIRED)
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::WinExtras Qt5::Concurrent)
else()
find_package(Qt5 5.11 COMPONENTS DBus Gui)
find_package(Qt5 5.14 COMPONENTS DBus Gui)
if(Qt5DBus_FOUND)
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::DBus Qt5::Network Qt5::Qml Qt5::Concurrent)
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::DBus Qt5::Concurrent)
target_compile_definitions(3rdparty_qt5 INTERFACE -DHAVE_QTDBUS)
else()
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::Network Qt5::Qml Qt5::Concurrent)
target_link_libraries(3rdparty_qt5 INTERFACE Qt5::Widgets Qt5::Concurrent)
endif()
target_include_directories(3rdparty_qt5 INTERFACE ${Qt5Gui_PRIVATE_INCLUDE_DIRS})
endif()
if(NOT Qt5Widgets_FOUND)
if(Qt5Widgets_VERSION VERSION_LESS 5.11.0)
message("Minimum supported Qt5 version is 5.11.0! You have version ${Qt5Widgets_VERSION} installed, please upgrade!")
if(Qt5Widgets_VERSION VERSION_LESS 5.14.0)
message("Minimum supported Qt5 version is 5.14.0! You have version ${Qt5Widgets_VERSION} installed, please upgrade!")
if(CMAKE_SYSTEM MATCHES "Linux")
message(FATAL_ERROR "Most distros do not provide an up-to-date version of Qt.
If you're on Ubuntu or Linux Mint, there are PPAs you can use to install one of the latest qt5 versions.
https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.11.0-bionic
https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.11.0-xenial
https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.14.1-bionic
https://launchpad.net/~beineri/+archive/ubuntu/opt-qt-5.14.1-xenial
just make sure to run
source /opt/qt511/bin/qt511-env.sh
source /opt/qt514/bin/qt514-env.sh
before re-running cmake")
elseif(WIN32)
message(FATAL_ERROR "You can download the latest version of Qt5 here: https://www.qt.io/download-open-source/")
@@ -35,7 +35,7 @@ before re-running cmake")
message("CMake was unable to find Qt5!")
if(WIN32)
message(FATAL_ERROR "Make sure the QTDIR env variable has been set properly. (for example C:\\Qt\\5.11.1\\msvc2017_64\\)
message(FATAL_ERROR "Make sure the QTDIR env variable has been set properly. (for example C:\\Qt\\5.14.1\\msvc2017_64\\)
You can also try setting the Qt5_DIR preprocessor definiton.")
elseif(CMAKE_SYSTEM MATCHES "Linux")
message(FATAL_ERROR "Make sure to install your distro's qt5 package!")
Vendored Submodule
+1
Submodule 3rdparty/wolfssl added at d0749c6549
+165
View File
@@ -0,0 +1,165 @@
<?xml version="1.0" encoding="utf-8"?>
<Project DefaultTargets="Build" ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup Label="ProjectConfigurations">
<ProjectConfiguration Include="Debug|x64">
<Configuration>Debug</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
<ProjectConfiguration Include="Release|x64">
<Configuration>Release</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
</ItemGroup>
<PropertyGroup Label="Globals">
<ProjectGuid>{73973223-5EE8-41CA-8E88-1D60E89A237B}</ProjectGuid>
<RootNamespace>wolfssl</RootNamespace>
<Keyword>Win32Proj</Keyword>
</PropertyGroup>
<Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<Import Project="..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType>
<CharacterSet>Unicode</CharacterSet>
<WholeProgramOptimization>true</WholeProgramOptimization>
</PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType>
<CharacterSet>Unicode</CharacterSet>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">
<Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
</ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="PropertySheets">
<Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
</ImportGroup>
<PropertyGroup Label="UserMacros" />
<PropertyGroup>
<OutDir>$(SolutionDir)lib\$(Configuration)-$(Platform)\</OutDir>
<IntDir>$(SolutionDir)tmp\$(ProjectName)-$(Configuration)-$(Platform)\</IntDir>
</PropertyGroup>
<ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<ClCompile>
<Optimization>Disabled</Optimization>
<AdditionalIncludeDirectories>./wolfssl;./wolfssl/IDE/WIN;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<BasicRuntimeChecks>EnableFastChecks</BasicRuntimeChecks>
<PrecompiledHeader>
</PrecompiledHeader>
<WarningLevel>Level4</WarningLevel>
<DebugInformationFormat>ProgramDatabase</DebugInformationFormat>
<DisableSpecificWarnings>4206;4214;4706;%(DisableSpecificWarnings)</DisableSpecificWarnings>
</ClCompile>
</ItemDefinitionGroup>
<ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<ClCompile>
<Optimization>MaxSpeed</Optimization>
<IntrinsicFunctions>true</IntrinsicFunctions>
<AdditionalIncludeDirectories>./wolfssl;./wolfssl/IDE/WIN;%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<PreprocessorDefinitions>WOLFSSL_LIB;WOLFSSL_USER_SETTINGS;CYASSL_USER_SETTINGS;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<FunctionLevelLinking>true</FunctionLevelLinking>
<PrecompiledHeader>
</PrecompiledHeader>
<WarningLevel>Level3</WarningLevel>
<DebugInformationFormat>ProgramDatabase</DebugInformationFormat>
</ClCompile>
</ItemDefinitionGroup>
<ItemGroup>
<ClCompile Include="wolfssl\src\crl.c" />
<ClCompile Include="wolfssl\src\internal.c" />
<ClCompile Include="wolfssl\src\wolfio.c" />
<ClCompile Include="wolfssl\src\keys.c" />
<ClCompile Include="wolfssl\src\ocsp.c" />
<ClCompile Include="wolfssl\src\ssl.c" />
<ClCompile Include="wolfssl\src\tls.c" />
<ClCompile Include="wolfssl\src\tls13.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\aes.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\arc4.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\asn.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\blake2b.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\blake2s.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\camellia.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\chacha.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\chacha20_poly1305.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\cmac.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\coding.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\curve25519.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\cpuid.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\des3.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\dh.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\dsa.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\ecc.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\ed25519.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\error.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\fe_operations.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\ge_low_mem.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\ge_operations.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\hash.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\hc128.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\hmac.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\idea.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\integer.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\logging.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\md2.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\md4.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\md5.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\memory.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\pkcs7.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\pkcs12.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\poly1305.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\pwdbased.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\rabbit.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\random.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\ripemd.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\rsa.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sha.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sha256.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sha3.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sha512.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\signature.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sp_c32.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sp_c64.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sp_int.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\sp_x86_64.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\srp.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\tfm.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\wc_encrypt.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\wc_pkcs11.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\wc_port.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\wolfmath.c" />
<ClCompile Include="wolfssl\wolfcrypt\src\wolfevent.c" />
</ItemGroup>
<ItemGroup>
<ClInclude Include="wolfssl\resource.h" />
<CustomBuild Include="wolfssl\wolfcrypt\src\aes_asm.asm">
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">false</ExcludedFromBuild>
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='DLL Debug|x64'">false</ExcludedFromBuild>
<Command Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">ml64.exe /c /Zi /Fo"$(OutDir)%(Filename).obj" %(Identity)</Command>
<Command Condition="'$(Configuration)|$(Platform)'=='DLL Debug|x64'">ml64.exe /c /Zi /Fo"$(IntDir)%(Filename).obj" %(Identity)</Command>
<Outputs Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">$(OutDir)%(Filename).obj</Outputs>
<Outputs Condition="'$(Configuration)|$(Platform)'=='DLL Debug|x64'">$(IntDir)%(Filename).obj</Outputs>
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='Release|x64'">false</ExcludedFromBuild>
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='DLL Release|x64'">false</ExcludedFromBuild>
<Command Condition="'$(Configuration)|$(Platform)'=='Release|x64'">ml64.exe /c /Zi /Fo"$(OutDir)%(Filename).obj" %(Identity)</Command>
<Command Condition="'$(Configuration)|$(Platform)'=='DLL Release|x64'">ml64.exe /c /Zi /Fo"$(IntDir)%(Filename).obj" %(Identity)</Command>
<Outputs Condition="'$(Configuration)|$(Platform)'=='Release|x64'">$(OutDir)%(Filename).obj</Outputs>
<Outputs Condition="'$(Configuration)|$(Platform)'=='DLL Release|x64'">$(IntDir)%(Filename).obj</Outputs>
</CustomBuild>
<ClInclude Include="wolfssl\IDE\WIN\user_settings.h" />
</ItemGroup>
<ItemGroup>
<ResourceCompile Include="wolfssl\wolfssl.rc">
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">true</ExcludedFromBuild>
<ExcludedFromBuild Condition="'$(Configuration)|$(Platform)'=='Release|x64'">true</ExcludedFromBuild>
</ResourceCompile>
</ItemGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />
<ImportGroup Label="ExtensionTargets">
</ImportGroup>
</Project>
+7 -1
View File
@@ -27,6 +27,9 @@
<UseDebugLibraries>false</UseDebugLibraries>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="PropertySheets">
@@ -41,7 +44,10 @@
</ImportGroup>
<PropertyGroup Label="UserMacros" />
<PropertyGroup />
<ItemDefinitionGroup>
<ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<ClCompile>
<Optimization>MaxSpeed</Optimization>
</ClCompile>
</ItemDefinitionGroup>
<ItemGroup>
<ClCompile Include="xxHash/xxhash.c" />
+9
View File
@@ -22,6 +22,9 @@
<CharacterSet>Unicode</CharacterSet>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="Shared">
@@ -37,6 +40,12 @@
<Import Project="..\rpcs3_release.props" />
</ImportGroup>
<PropertyGroup Label="UserMacros" />
<ItemDefinitionGroup>
<ClCompile>
<ExceptionHandling>Sync</ExceptionHandling>
<Optimization Condition="'$(Configuration)|$(Platform)'=='Release|x64'">MaxSpeed</Optimization>
</ClCompile>
</ItemDefinitionGroup>
<ItemGroup>
<ClCompile Include="yaml-cpp\src\binary.cpp">
</ClCompile>
+4 -1
View File
@@ -31,6 +31,9 @@
<Import Project="$(SolutionDir)\3rdparty\zlib.props" />
<Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<Import Project="..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType>
@@ -79,7 +82,7 @@
<ClCompile>
<WarningLevel>$(WarningLevel)</WarningLevel>
<DebugInformationFormat>ProgramDatabase</DebugInformationFormat>
<Optimization>Full</Optimization>
<Optimization>MaxSpeed</Optimization>
<IntrinsicFunctions>true</IntrinsicFunctions>
<WholeProgramOptimization>true</WholeProgramOptimization>
<BufferSecurityCheck>false</BufferSecurityCheck>
+38 -27
View File
@@ -9,20 +9,20 @@ Other instructions may be found [here](https://wiki.rpcs3.net/index.php?title=Bu
* [CMake 3.14.1+](https://www.cmake.org/download/) (add to PATH)
* [Python 3.3+](https://www.python.org/downloads/) (add to PATH)
* [Qt 5.11+](https://www.qt.io/download-qt-installer) (Avoid 5.11.1, due to a bug)
* [Qt 5.14.2](https://www.qt.io/download-qt-installer)
* [Visual Studio 2019](https://visualstudio.microsoft.com/thank-you-downloading-visual-studio/?sku=Community)
* [Vulkan SDK 1.1.97.0+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/windows/getting_started.html))
* [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/windows/getting_started.html))
**Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.11.0\msvc2017_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools-19123)**
**Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.14.2\msvc2017_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools-19123)**
### Linux
These are the essentials tools to build RPCS3 on Linux. Some of them can be installed through your favorite package manager.
* Clang 5.0+ or GCC 8.1+
* [CMake 3.8.2+](https://www.cmake.org/download/)
* [Qt 5.11+](https://www.qt.io/download-qt-installer) (Avoid 5.11.1, due to a bug)
* [Vulkan SDK 1.1.97.0+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/linux/getting_started.html))
* Clang 9+ or GCC 9+
* [CMake 3.14.1+](https://www.cmake.org/download/)
* [Qt 5.14.2](https://www.qt.io/download-qt-installer)
* [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/linux/getting_started.html))
* [SDL2](https://www.libsdl.org/download-2.0.php) (for the FAudio backend)
**If you have an NVIDIA GPU, you may need to install the libglvnd package.**
@@ -33,40 +33,51 @@ These are the essentials tools to build RPCS3 on Linux. Some of them can be inst
#### Debian & Ubuntu
sudo apt-get install cmake build-essential libasound2-dev libpulse-dev libopenal-dev libglew-dev zlib1g-dev libedit-dev libvulkan-dev libudev-dev git qt5-default libevdev-dev qtdeclarative5-dev qtbase5-private-dev libsdl2-2.0 libsdl2-dev
sudo apt-get install build-essential libasound2-dev libpulse-dev libopenal-dev libglew-dev zlib1g-dev libedit-dev libvulkan-dev libudev-dev git libevdev-dev libsdl2-2.0 libsdl2-dev
##### GCC 8.x installation
Ubuntu is usually horrendously out of date, and some packages need to be downloaded by hand. This part is for Qt, GCC, Vulkan, and CMake
##### Qt PPA
If the `gcc-8` package is not available on your system, use the following command
Ubuntu usually does not have a new enough Qt package to suit rpcs3's needs. There is a PPA available to work around this. Run the following:
```
ucodename=$(lsb_release -sc)
sudo add-apt-repository ppa:beineri/opt-qt-5.14.2-$ucodename
sudo apt-get update
. /opt/qt514/bin/qt514-env.sh >/dev/null 2>&1
sudo apt-get install qt514-meta-minimal qt514svg
```
##### GCC 9.x installation
If the `gcc-9` package is not available on your system, use the following commands
```
sudo add-apt-repository ppa:ubuntu-toolchain-r/test
```
Then
```
sudo apt-get update
sudo apt-get install gcc-8 g++-8
sudo apt-get install gcc-9 g++-9
```
You can either use `update-alternatives` to setup `gcc-8`/`g++-8` as your default compilers or prefix any `cmake` command by `CXX=g++-8 CC=gcc-8 ` to use it.
You can either use `update-alternatives` to setup `gcc-9`/`g++-9` as your default compilers or prefix any `cmake` command by `CXX=g++-9 CC=gcc-9 ` to use it.
##### Vulkan SDK
For Ubuntu systems, it is strongly recommended to use the PPA from [LunarG](https://packages.lunarg.com/) which will provide a compatible Vulkan SDK to compile RPCS3. If your Vulkan SDK is older, it can lead to compilation errors.
Ubuntu 18.04 (Bionic Beaver)
```
ucodename=$(lsb_release -sc)
wget -qO - http://packages.lunarg.com/lunarg-signing-key-pub.asc | sudo apt-key add -
sudo wget -qO /etc/apt/sources.list.d/lunarg-vulkan-1.1.106-bionic.list http://packages.lunarg.com/vulkan/1.1.106/lunarg-vulkan-1.1.106-bionic.list
sudo wget -qO /etc/apt/sources.list.d/lunarg-vulkan-1.1.126-$ucodename.list http://packages.lunarg.com/vulkan/1.1.126/lunarg-vulkan-1.1.126-$ucodename.list
sudo apt update
sudo apt install vulkan-sdk
```
Ubuntu 16.04 (Xenial Xerus)
##### CMake
```
wget -qO - http://packages.lunarg.com/lunarg-signing-key-pub.asc | sudo apt-key add -
sudo wget -qO /etc/apt/sources.list.d/lunarg-vulkan-1.1.106-xenial.list http://packages.lunarg.com/vulkan/1.1.106/lunarg-vulkan-1.1.106-xenial.list
sudo apt update
sudo apt install vulkan-sdk
wget -O - https://apt.kitware.com/keys/kitware-archive-latest.asc 2>/dev/null | sudo apt-key add -
sudo apt-add-repository "deb https://apt.kitware.com/ubuntu/ $(lsb_release -sc) main"
sudo apt-get update
sudo apt-get install kitware-archive-keyring
sudo apt-key --keyring /etc/apt/trusted.gpg del C1F34CDD40CD72DA
sudo apt-get install cmake
```
#### Fedora
@@ -92,16 +103,16 @@ git submodule update --init
#### Configuring the Qt plugin (if used)
1) Go to the Qt5 menu and edit Qt5 options.
2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.11.0\msvc2017_64`.
2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.14.2\msvc2017_64`.
3) While selecting the rpcs3qt project, go to Qt5->Project Setting and select the version you added.
#### Building the projects
Open `rpcs3.sln`. The recommended build configuration is `Release - LLVM` for all purposes.
You may want to download precompiled [LLVM libs](https://github.com/RPCS3/llvm/releases/download/continuous-master/llvmlibs.7z) and extract to root rpcs3 folder (which contains `rpcs3.sln`), as well as download and extract [additional libs](https://drive.google.com/uc?export=download&id=1A2eOMmCO714i0U7J0qI4aEMKnuWl8l_R) to `lib\%CONFIGURATION%-x64\` to speed up compilation time (unoptimised/debug libs are currently not available precompiled).
You may want to download the precompiled [LLVM libs](https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z) and extract them to the root rpcs3 folder (which contains `rpcs3.sln`), as well as download and extract the [additional libs](https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z) to `lib\%CONFIGURATION%-x64\` to speed up compilation time (unoptimised/debug libs are currently not available precompiled).
If you're not using precompiled libs, build the projects in *__BUILD_BEFORE* folder: right-click on every project > *Build*.
If you're not using the precompiled libs, build the projects in *__BUILD_BEFORE* folder: right-click on every project > *Build*.
`Build > Build Solution`
@@ -110,7 +121,7 @@ If you're not using precompiled libs, build the projects in *__BUILD_BEFORE* fol
While still in the project root:
1) `cd .. && mkdir rpcs3_build && cd rpcs3_build`
2) `cmake ../rpcs3/ && make` or `CXX=g++-8 CC=gcc-8 cmake ../rpcs3/ && make` to force these compilers
2) `cmake ../rpcs3/ && make` or `CXX=g++-9 CC=gcc-9 cmake ../rpcs3/ && make` to force these compilers
3) Run RPCS3 with `./bin/rpcs3`
When using GDB, configure it to ignore SIGSEGV signal (`handle SIGSEGV nostop noprint`).
+7 -6
View File
@@ -1,14 +1,14 @@
cmake_minimum_required(VERSION 3.8.2)
cmake_minimum_required(VERSION 3.14.1)
project(rpcs3)
if(CMAKE_COMPILER_IS_GNUCXX)
if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 8)
message(FATAL_ERROR "RPCS3 requires at least gcc-8.")
if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 9)
message(FATAL_ERROR "RPCS3 requires at least gcc-9.")
endif()
elseif(${CMAKE_CXX_COMPILER_ID} MATCHES "Clang")
if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 5.0)
message(FATAL_ERROR "RPCS3 requires at least clang-5.0.")
if(CMAKE_CXX_COMPILER_VERSION VERSION_LESS 9.0)
message(FATAL_ERROR "RPCS3 requires at least clang-9.0.")
endif()
endif()
@@ -22,10 +22,11 @@ option(USE_LIBEVDEV "libevdev-based joystick support" ON)
option(USE_DISCORD_RPC "Discord rich presence integration" ON)
option(USE_SYSTEM_ZLIB "Prefer system ZLIB instead of the builtin one" ON)
option(USE_VULKAN "Vulkan render backend" ON)
option(USE_PRECOMPILED_HEADERS "Use precompiled headers" ON)
set(CMAKE_MODULE_PATH "${CMAKE_CURRENT_LIST_DIR}/rpcs3/cmake_modules")
set(CMAKE_CXX_STANDARD 17)
set(CMAKE_CXX_STANDARD 20)
include(CheckCXXCompilerFlag)
if (NOT CMAKE_BUILD_TYPE)
+5 -3
View File
@@ -1,8 +1,10 @@
RPCS3
=====
[![Build Status](https://travis-ci.org/RPCS3/rpcs3.svg?branch=master)](https://travis-ci.org/RPCS3/rpcs3)
[![Build status](https://ci.appveyor.com/api/projects/status/411c4clmiohtx7eo/branch/master?svg=true)](https://ci.appveyor.com/project/rpcs3/rpcs3/branch/master)
[![Travis (.org) branch](https://img.shields.io/travis/RPCS3/rpcs3/master?label=Travis%20CI&logo=travis)](https://travis-ci.org/RPCS3/rpcs3)
[![Azure Build Status](https://dev.azure.com/nekotekina/nekotekina/_apis/build/status/RPCS3.rpcs3?branchName=master)](https://dev.azure.com/nekotekina/nekotekina/_build?definitionId=4&branchName=master)
[![Cirrus CI - Base Branch Build Status](https://img.shields.io/cirrus/github/RPCS3/rpcs3?label=Cirrus%20CI%20(FreeBSD)&logo=cirrus-ci)](https://cirrus-ci.com/github/RPCS3/rpcs3)
[![RPCS3 discord server](https://img.shields.io/discord/272035812277878785?color=%237289DA&label=RPCS3%20Discord&logo=discord&logoColor=white)](https://discord.me/rpcs3)
The world's first free and open-source PlayStation 3 emulator/debugger, written in C++ for Windows and Linux.
@@ -32,7 +34,7 @@ See [BUILDING.md](BUILDING.md) for more information about how to setup an enviro
Check our friendly [quickstart](https://rpcs3.net/quickstart) guide to make sure your computer meets the minimum system requirements to run RPCS3.
Don't forget to have your graphics driver up to date and to install the [Visual C++ Redistributable Packages for Visual Studio 2017](https://go.microsoft.com/fwlink/?LinkId=746572) if you are a Windows user.
Don't forget to have your graphics driver up to date and to install the [Visual C++ Redistributable Packages for Visual Studio 2019](https://aka.ms/vs/16/release/VC_redist.x64.exe) if you are a Windows user.
## License
+101 -31
View File
@@ -1,37 +1,44 @@
#pragma once
#ifndef BETYPE_H_GUARD
#define BETYPE_H_GUARD
#include "types.h"
#include "util/endian.hpp"
#include <cstring>
#include <cmath>
#if __has_include(<bit>)
#include <bit>
#else
#include <type_traits>
#endif
// 128-bit vector type and also se_storage<> storage type
union alignas(16) v128
{
char _bytes[16];
uchar _bytes[16];
char _chars[16];
template <typename T, std::size_t N, std::size_t M>
struct masked_array_t // array type accessed as (index ^ M)
{
T m_data[N];
char m_data[16];
public:
T& operator[](std::size_t index)
{
return m_data[index ^ M];
return reinterpret_cast<T*>(m_data)[index ^ M];
}
const T& operator[](std::size_t index) const
{
return m_data[index ^ M];
return reinterpret_cast<const T*>(m_data)[index ^ M];
}
};
#if IS_LE_MACHINE == 1
template <typename T, std::size_t N = 16 / sizeof(T)>
using normal_array_t = masked_array_t<T, N, 0>;
using normal_array_t = masked_array_t<T, N, std::endian::little == std::endian::native ? 0 : N - 1>;
template <typename T, std::size_t N = 16 / sizeof(T)>
using reversed_array_t = masked_array_t<T, N, N - 1>;
#endif
using reversed_array_t = masked_array_t<T, N, std::endian::little == std::endian::native ? N - 1 : 0>;
normal_array_t<u64> _u64;
normal_array_t<s64> _s64;
@@ -64,7 +71,7 @@ union alignas(16) v128
struct bit_array_128
{
u64 m_data[2];
char m_data[16];
public:
class bit_element
@@ -114,17 +121,31 @@ union alignas(16) v128
// Index 0 returns the MSB and index 127 returns the LSB
bit_element operator[](u32 index)
{
#if IS_LE_MACHINE == 1
return bit_element(m_data[1 - (index >> 6)], 0x8000000000000000ull >> (index & 0x3F));
#endif
const auto data_ptr = reinterpret_cast<u64*>(m_data);
if constexpr (std::endian::little == std::endian::native)
{
return bit_element(data_ptr[1 - (index >> 6)], 0x8000000000000000ull >> (index & 0x3F));
}
else
{
return bit_element(data_ptr[index >> 6], 0x8000000000000000ull >> (index & 0x3F));
}
}
// Index 0 returns the MSB and index 127 returns the LSB
bool operator[](u32 index) const
{
#if IS_LE_MACHINE == 1
return (m_data[1 - (index >> 6)] & (0x8000000000000000ull >> (index & 0x3F))) != 0;
#endif
const auto data_ptr = reinterpret_cast<const u64*>(m_data);
if constexpr (std::endian::little == std::endian::native)
{
return (data_ptr[1 - (index >> 6)] & (0x8000000000000000ull >> (index & 0x3F))) != 0;
}
else
{
return (data_ptr[index >> 6] & (0x8000000000000000ull >> (index & 0x3F))) != 0;
}
}
} _bit;
@@ -205,6 +226,20 @@ union alignas(16) v128
return ret;
}
// Unaligned load with optional index offset
static v128 loadu(const void* ptr, std::size_t index = 0)
{
v128 ret;
std::memcpy(&ret, static_cast<const u8*>(ptr) + index * sizeof(v128), sizeof(v128));
return ret;
}
// Unaligned store with optional index offset
static void storeu(v128 value, void* ptr, std::size_t index = 0)
{
std::memcpy(static_cast<u8*>(ptr) + index * sizeof(v128), &value, sizeof(v128));
}
static inline v128 add8(const v128& left, const v128& right)
{
return fromV(_mm_add_epi8(left.vi, right.vi));
@@ -280,14 +315,54 @@ union alignas(16) v128
return fromV(_mm_cmpeq_epi32(left.vi, right.vi));
}
static inline v128 eq32f(const v128& left, const v128& right)
{
return fromF(_mm_cmpeq_ps(left.vf, right.vf));
}
static inline v128 eq64f(const v128& left, const v128& right)
{
return fromD(_mm_cmpeq_pd(left.vd, right.vd));
}
static inline bool use_fma = false;
static inline v128 fma32f(v128 a, const v128& b, const v128& c)
{
#ifndef __FMA__
if (use_fma) [[likely]]
{
#ifdef _MSC_VER
a.vf = _mm_fmadd_ps(a.vf, b.vf, c.vf);
return a;
#else
__asm__("vfmadd213ps %[c], %[b], %[a]"
: [a] "+x" (a.vf)
: [b] "x" (b.vf)
, [c] "x" (c.vf));
return a;
#endif
}
for (int i = 0; i < 4; i++)
{
a._f[i] = std::fmaf(a._f[i], b._f[i], c._f[i]);
}
return a;
#else
a.vf = _mm_fmadd_ps(a.vf, b.vf, c.vf);
return a;
#endif
}
bool operator==(const v128& right) const
{
return _u64[0] == right._u64[0] && _u64[1] == right._u64[1];
return _mm_movemask_epi8(v128::eq32(*this, right).vi) == 0xffff;
}
bool operator!=(const v128& right) const
{
return _u64[0] != right._u64[0] || _u64[1] != right._u64[1];
return !operator==(right);
}
// result = (~left) & (right)
@@ -298,8 +373,7 @@ union alignas(16) v128
void clear()
{
_u64[0] = 0;
_u64[1] = 0;
*this = {};
}
};
@@ -330,7 +404,7 @@ inline v128 operator^(const v128& left, const v128& right)
inline v128 operator~(const v128& other)
{
return v128::from64(~other._u64[0], ~other._u64[1]);
return other ^ v128::from32p(UINT32_MAX); // XOR with ones
}
using stx::se_t;
@@ -340,12 +414,10 @@ using stx::se_storage;
template <typename T, std::size_t Align = alignof(T)>
using nse_t = se_t<T, false, Align>;
#if IS_LE_MACHINE == 1
template <typename T, std::size_t Align = alignof(T)>
using be_t = se_t<T, true, Align>;
using be_t = se_t<T, std::endian::little == std::endian::native, Align>;
template <typename T, std::size_t Align = alignof(T)>
using le_t = se_t<T, false, Align>;
#endif
using le_t = se_t<T, std::endian::big == std::endian::native, Align>;
// Type converter: converts native endianness arithmetic/enum types to appropriate se_t<> type
template <typename T, bool Se, typename = void>
@@ -414,20 +486,16 @@ struct to_se<T[N], Se>
};
// BE/LE aliases for to_se<>
#if IS_LE_MACHINE == 1
template <typename T>
using to_be_t = typename to_se<T, true>::type;
using to_be_t = typename to_se<T, std::endian::little == std::endian::native>::type;
template <typename T>
using to_le_t = typename to_se<T, false>::type;
#endif
using to_le_t = typename to_se<T, std::endian::big == std::endian::native>::type;
// BE/LE aliases for atomic_t
#if IS_LE_MACHINE == 1
template <typename T>
using atomic_be_t = atomic_t<be_t<T>>;
template <typename T>
using atomic_le_t = atomic_t<le_t<T>>;
#endif
template <typename T, bool Se, std::size_t Align>
struct fmt_unveil<se_t<T, Se, Align>, void>
@@ -439,3 +507,5 @@ struct fmt_unveil<se_t<T, Se, Align>, void>
return fmt_unveil<T>::get(arg);
}
};
#endif // BETYPE_H_GUARD
+2 -2
View File
@@ -11,7 +11,7 @@ struct bf_base
// Datatype bitsize
static constexpr uint bitmax = sizeof(T) * 8; static_assert(N - 1 < bitmax, "bf_base<> error: N out of bounds");
// Field bitsize
static constexpr uint bitsize = N;
@@ -96,7 +96,7 @@ struct bf_t : bf_base<T, N>
// Optimized bool conversion (must be removed if inappropriate)
explicit constexpr operator bool() const
{
return unshifted() != 0;
return unshifted() != 0u;
}
// Store bitfield value
+74 -25
View File
@@ -1,11 +1,16 @@
#include "stdafx.h"
#include "stdafx.h"
#include "Config.h"
#include "Utilities/types.h"
#include "yaml-cpp/yaml.h"
#include "util/yaml.hpp"
#include <typeinfo>
#include <charconv>
[[noreturn]] void report_fatal_error(const std::string&);
LOG_CHANNEL(cfg_log, "CFG");
namespace cfg
{
_base::_base(type _type)
@@ -13,7 +18,7 @@ namespace cfg
{
if (_type != type::node)
{
fmt::throw_exception("Invalid root node" HERE);
cfg_log.fatal("Invalid root node" HERE);
}
}
@@ -24,7 +29,7 @@ namespace cfg
{
if (pair.first == name)
{
fmt::throw_exception("Node already exists: %s" HERE, name);
cfg_log.fatal("Node already exists: %s" HERE, name);
}
}
@@ -33,12 +38,12 @@ namespace cfg
bool _base::from_string(const std::string&, bool)
{
fmt::throw_exception("from_string() purecall" HERE);
report_fatal_error("from_string() purecall" HERE);
}
bool _base::from_list(std::vector<std::string>&&)
{
fmt::throw_exception("from_list() purecall" HERE);
report_fatal_error("from_list() purecall" HERE);
}
// Emit YAML
@@ -60,6 +65,52 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
const char* start = &value.front();
const char* end = &value.back() + 1;
int base = 10;
int sign = +1;
if (start[0] == '-')
{
sign = -1;
start += 1;
}
if (start[0] == '0' && (start[1] == 'x' || start[1] == 'X'))
{
// Limited hex support
base = 16;
start += 2;
}
const auto ret = std::from_chars(start, end, result, base);
if (ret.ec != std::errc() || ret.ptr != end || (start[0] == '-' && sign < 0))
{
if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value);
return false;
}
result *= sign;
if (result < min || result > max)
{
if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%d..%d)", value, min, max);
return false;
}
if (out) *out = result;
return true;
}
std::vector<std::string> cfg::make_uint_range(u64 min, u64 max)
{
return {std::to_string(min), std::to_string(max)};
}
bool cfg::try_to_uint64(u64* out, const std::string& value, u64 min, u64 max)
{
u64 result;
const char* start = &value.front();
const char* end = &value.back() + 1;
int base = 10;
if (start[0] == '0' && (start[1] == 'x' || start[1] == 'X'))
{
@@ -72,13 +123,13 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
if (ret.ec != std::errc() || ret.ptr != end)
{
if (out) LOG_ERROR(GENERAL, "cfg::try_to_int('%s'): invalid integer", value);
if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value);
return false;
}
if (result < min || result > max)
{
if (out) LOG_ERROR(GENERAL, "cfg::try_to_int('%s'): out of bounds (%lld..%lld)", value, min, max);
if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%u..%u)", value, min, max);
return false;
}
@@ -127,13 +178,13 @@ bool cfg::try_to_enum_value(u64* out, decltype(&fmt_class_string<int>::format) f
if (ret.ec != std::errc() || ret.ptr != end)
{
if (out) LOG_ERROR(GENERAL, "cfg::try_to_enum_value('%s'): invalid enum or integer", value);
if (out) cfg_log.error("cfg::try_to_enum_value('%s'): invalid enum or integer", value);
return false;
}
if (result > max)
{
if (out) LOG_ERROR(GENERAL, "cfg::try_to_enum_value('%s'): out of bounds(0..%u)", value, max);
if (out) cfg_log.error("cfg::try_to_enum_value('%s'): out of bounds(0..%u)", value, max);
return false;
}
@@ -284,7 +335,7 @@ void cfg::decode(const YAML::Node& data, cfg::_base& rhs, bool dynamic)
if (YAML::convert<std::string>::decode(data, value))
{
rhs.from_string(value);
rhs.from_string(value, dynamic);
}
break; // ???
@@ -300,14 +351,17 @@ std::string cfg::node::to_string() const
return {out.c_str(), out.size()};
}
bool cfg::node::from_string(const std::string& value, bool dynamic) try
bool cfg::node::from_string(const std::string& value, bool dynamic)
{
cfg::decode(YAML::Load(value), *this, dynamic);
return true;
}
catch (const std::exception& e)
{
LOG_FATAL(GENERAL, "%s thrown: %s", typeid(e).name(), e.what());
auto [result, error] = yaml_load(value);
if (error.empty())
{
cfg::decode(result, *this, dynamic);
return true;
}
cfg_log.fatal("Failed to load node: %s", error);
return false;
}
@@ -326,7 +380,7 @@ void cfg::_bool::from_default()
void cfg::string::from_default()
{
m_value = def;
m_value = m_value.make(def);
}
void cfg::set_entry::from_default()
@@ -336,12 +390,7 @@ void cfg::set_entry::from_default()
void cfg::log_entry::set_map(std::map<std::string, logs::level>&& map)
{
logs::reset();
for (auto&& pair : (m_map = std::move(map)))
{
logs::set_level(pair.first, pair.second);
}
m_map = std::move(map);
}
void cfg::log_entry::from_default()
+122 -33
View File
@@ -2,7 +2,9 @@
#include "Utilities/types.h"
#include "Utilities/StrFmt.h"
#include "Utilities/Log.h"
#include "util/logs.hpp"
#include "util/atomic.hpp"
#include "util/shared_cptr.hpp"
#include <utility>
#include <string>
@@ -18,6 +20,12 @@ namespace cfg
// Convert string to signed integer
bool try_to_int64(s64* out, const std::string& value, s64 min, s64 max);
// Format min and max unsigned values
std::vector<std::string> make_uint_range(u64 min, u64 max);
// Convert string to unsigned integer
bool try_to_uint64(u64* out, const std::string& value, u64 min, u64 max);
// Internal hack
bool try_to_enum_value(u64* out, decltype(&fmt_class_string<int>::format) func, const std::string&);
@@ -25,12 +33,13 @@ namespace cfg
std::vector<std::string> try_to_enum_list(decltype(&fmt_class_string<int>::format) func);
// Config tree entry type.
enum class type : uint
enum class type : unsigned
{
node = 0, // cfg::node type
_bool, // cfg::_bool type
_enum, // cfg::_enum type
_int, // cfg::_int type
uint, // cfg::uint type
string, // cfg::string type
set, // cfg::set_entry type
log,
@@ -48,7 +57,7 @@ namespace cfg
_base(type _type);
// Owned entry constructor
_base(type _type, class node* owner, const std::string& name, bool dynamic = true);
_base(type _type, class node* owner, const std::string& name, bool dynamic);
public:
_base(const _base&) = delete;
@@ -121,7 +130,7 @@ namespace cfg
class _bool final : public _base
{
bool m_value;
atomic_t<bool> m_value;
public:
bool def;
@@ -138,7 +147,7 @@ namespace cfg
return m_value;
}
const bool& get() const
bool get() const
{
return m_value;
}
@@ -172,7 +181,7 @@ namespace cfg
template <typename T>
class _enum final : public _base
{
T m_value;
atomic_t<T> m_value;
public:
const T def;
@@ -189,7 +198,7 @@ namespace cfg
return m_value;
}
const T& get() const
T get() const
{
return m_value;
}
@@ -202,7 +211,7 @@ namespace cfg
std::string to_string() const override
{
std::string result;
fmt_class_string<T>::format(result, fmt_unveil<T>::get(m_value));
fmt_class_string<T>::format(result, fmt_unveil<T>::get(m_value.load()));
return result; // TODO: ???
}
@@ -235,7 +244,7 @@ namespace cfg
// Prefer 32 bit type if possible
using int_type = std::conditional_t<Min >= INT32_MIN && Max <= INT32_MAX, s32, s64>;
int_type m_value;
atomic_t<int_type> m_value;
public:
int_type def;
@@ -256,7 +265,7 @@ namespace cfg
return m_value;
}
const int_type& get() const
int_type get() const
{
return m_value;
}
@@ -300,66 +309,146 @@ namespace cfg
// Alias for 64 bit int
using int64 = _int<INT64_MIN, INT64_MAX>;
// Simple string entry with mutex
class string final : public _base
// Unsigned 32/64-bit integer entry with custom Min/Max range.
template <u64 Min, u64 Max>
class uint final : public _base
{
std::string m_name;
std::string m_value;
static_assert(Min < Max, "Invalid cfg::uint range");
// Prefer 32 bit type if possible
using int_type = std::conditional_t<Max <= UINT32_MAX, u32, u64>;
atomic_t<int_type> m_value;
public:
std::string def;
int_type def;
string(node* owner, const std::string& name, const std::string& def = {}, bool dynamic = false)
: _base(type::string, owner, name, dynamic)
, m_name(name)
// Expose range
static const u64 max = Max;
static const u64 min = Min;
uint(node* owner, const std::string& name, int_type def = std::max<int_type>(Min, 0), bool dynamic = false)
: _base(type::uint, owner, name, dynamic)
, m_value(def)
, def(def)
{
}
operator int_type() const
{
return m_value;
}
int_type get() const
{
return m_value;
}
void from_default() override
{
m_value = def;
}
std::string to_string() const override
{
return std::to_string(m_value);
}
bool from_string(const std::string& value, bool /*dynamic*/ = false) override
{
u64 result;
if (try_to_uint64(&result, value, Min, Max))
{
m_value = static_cast<int_type>(result);
return true;
}
return false;
}
void set(const u64& value)
{
m_value = static_cast<int_type>(value);
}
std::vector<std::string> to_list() const override
{
return make_uint_range(Min, Max);
}
};
// Alias for 32 bit uint
using uint32 = uint<0, UINT32_MAX>;
// Alias for 64 bit int
using uint64 = uint<0, UINT64_MAX>;
// Simple string entry with mutex
class string : public _base
{
const std::string m_name;
stx::atomic_cptr<std::string> m_value;
public:
std::string def;
string(node* owner, std::string name, std::string def = {}, bool dynamic = false)
: _base(type::string, owner, name, dynamic)
, m_name(std::move(name))
, m_value(m_value.make(def))
, def(std::move(def))
{
}
operator std::string() const
{
return m_value;
return *m_value.load().get();
}
const std::string& get() const
std::pair<const std::string&, stx::shared_cptr<std::string>> get() const
{
return m_value;
auto v = m_value.load();
if (auto s = v.get())
{
return {*s, std::move(v)};
}
else
{
static const std::string _empty;
return {_empty, {}};
}
}
std::string get_name() const
const std::string& get_name() const
{
return m_name;
}
std::size_t size() const
{
return m_value.size();
}
void from_default() override;
std::string to_string() const override
{
return m_value;
return *m_value.load().get();
}
bool from_string(const std::string& value, bool /*dynamic*/ = false) override
{
m_value = value;
m_value = m_value.make(value);
return true;
}
};
// Simple set entry with mutex (TODO: template for various types)
// Simple set entry (TODO: template for various types)
class set_entry final : public _base
{
std::set<std::string> m_set;
public:
// Default value is empty list in current implementation
set_entry(node* owner, const std::string& name, bool dynamic = false)
: _base(type::set, owner, name, dynamic)
set_entry(node* owner, const std::string& name)
: _base(type::set, owner, name, false)
{
}
@@ -394,7 +483,7 @@ namespace cfg
public:
log_entry(node* owner, const std::string& name)
: _base(type::log, owner, name)
: _base(type::log, owner, name, true)
{
}
+32 -19
View File
@@ -129,8 +129,8 @@ static fs::error to_error(DWORD e)
case ERROR_DIR_NOT_EMPTY: return fs::error::notempty;
case ERROR_NOT_READY: return fs::error::noent;
case ERROR_FILENAME_EXCED_RANGE: return fs::error::toolong;
//case ERROR_INVALID_PARAMETER: return fs::error::inval;
default: fmt::throw_exception("Unknown Win32 error: %u.", e);
case ERROR_DISK_FULL: return fs::error::nospace;
default: return fs::error::unknown;
}
}
@@ -171,7 +171,8 @@ static fs::error to_error(int e)
case ENOTEMPTY: return fs::error::notempty;
case EROFS: return fs::error::readonly;
case EISDIR: return fs::error::isdir;
default: fmt::throw_exception("Unknown system error: %d.", e);
case ENOSPC: return fs::error::nospace;
default: return fs::error::unknown;
}
}
@@ -304,7 +305,7 @@ std::shared_ptr<fs::device_base> fs::device_manager::set_device(const std::strin
std::shared_ptr<fs::device_base> fs::get_virtual_device(const std::string& path)
{
// Every virtual device path must have "//" at the beginning
if (path.size() > 2 && reinterpret_cast<const u16&>(path.front()) == "//"_u16)
if (path.starts_with("//"))
{
return get_device_manager().get_device(path);
}
@@ -314,7 +315,7 @@ std::shared_ptr<fs::device_base> fs::get_virtual_device(const std::string& path)
std::shared_ptr<fs::device_base> fs::set_virtual_device(const std::string& name, const std::shared_ptr<device_base>& device)
{
verify(HERE), name.size() > 2, name[0] == '/', name[1] == '/', name.find('/', 2) == -1;
verify(HERE), name.starts_with("//"), name[2] != '/';
return get_device_manager().set_device(name, device);
}
@@ -338,7 +339,7 @@ std::string fs::get_parent_dir(const std::string& path)
if (std::exchange(last, pos - 1) != pos)
{
// Return empty string if the path doesn't contain at least 2 elements
return path.substr(0, pos != -1 && path.find_last_not_of(delim, pos, sizeof(delim) - 1) != -1 ? pos : 0);
return path.substr(0, pos != umax && path.find_last_not_of(delim, pos, sizeof(delim) - 1) != umax ? pos : 0);
}
}
}
@@ -1147,7 +1148,7 @@ fs::file::file(const std::string& path, bs_t<open_mode> mode)
return;
}
if (mode & fs::trunc && mode & (fs::lock + fs::unread))
if (mode & fs::trunc && mode & (fs::lock + fs::unread) && mode & fs::write)
{
// Postpone truncation in order to avoid using O_TRUNC on a locked file
verify(HERE), ::ftruncate(fd, 0) == 0;
@@ -1314,8 +1315,7 @@ fs::file::file(const void* ptr, std::size_t size)
const s64 new_pos =
whence == fs::seek_set ? offset :
whence == fs::seek_cur ? offset + m_pos :
whence == fs::seek_end ? offset + size() :
(fmt::raw_error("fs::file::memory_stream::seek(): invalid whence"), 0);
whence == fs::seek_end ? offset + size() : -1;
if (new_pos < 0)
{
@@ -1605,15 +1605,14 @@ bool fs::remove_all(const std::string& path, bool remove_root)
continue;
}
if (entry.is_directory == false)
if (!entry.is_directory)
{
if (!remove_file(path_append(path, entry.name)))
{
return false;
}
}
if (entry.is_directory == true)
else
{
if (!remove_all(path_append(path, entry.name)))
{
@@ -1639,21 +1638,34 @@ u64 fs::get_dir_size(const std::string& path, u64 rounding_alignment)
{
u64 result = 0;
for (const auto entry : dir(path))
const auto root_dir = dir(path);
if (!root_dir)
{
return static_cast<u64>(umax);
}
for (const auto& entry : root_dir)
{
if (entry.name == "." || entry.name == "..")
{
continue;
}
if (entry.is_directory == false)
if (!entry.is_directory)
{
result += ::align(entry.size, rounding_alignment);
}
if (entry.is_directory == true)
else
{
result += get_dir_size(path_append(path, entry.name), rounding_alignment);
const u64 size = get_dir_size(path_append(path, entry.name), rounding_alignment);
if (size == umax)
{
return size;
}
result += size;
}
}
@@ -1752,8 +1764,7 @@ fs::file fs::make_gather(std::vector<fs::file> files)
const s64 new_pos =
whence == fs::seek_set ? offset :
whence == fs::seek_cur ? offset + pos :
whence == fs::seek_end ? offset + end :
(fmt::raw_error("fs::gather_stream::seek(): invalid whence"), 0);
whence == fs::seek_end ? offset + end : -1;
if (new_pos < 0)
{
@@ -1809,6 +1820,8 @@ void fmt_class_string<fs::error>::format(std::string& out, u64 arg)
case fs::error::readonly: return "Read only";
case fs::error::isdir: return "Is a directory";
case fs::error::toolong: return "Path too long";
case fs::error::nospace: return "Not enough space on the device";
case fs::error::unknown: return "Unknown system error";
}
return unknown;
+16 -15
View File
@@ -290,16 +290,16 @@ namespace fs
}
// Write POD unconditionally
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, const file&> write(const T& data) const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const T& data) const
{
if (write(std::addressof(data), sizeof(T)) != sizeof(T)) xfail();
return *this;
}
// Write POD std::vector unconditionally
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, const file&> write(const std::vector<T>& vec) const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, const file&> write(const std::vector<T>& vec) const
{
if (write(vec.data(), vec.size() * sizeof(T)) != vec.size() * sizeof(T)) xfail();
return *this;
@@ -319,30 +319,30 @@ namespace fs
}
// Read POD, sizeof(T) is used
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, bool> read(T& data) const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(T& data) const
{
return read(&data, sizeof(T)) == sizeof(T);
}
// Read POD std::vector, size must be set by resize() method
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, bool> read(std::vector<T>& vec) const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec) const
{
return read(vec.data(), sizeof(T) * vec.size()) == sizeof(T) * vec.size();
}
// Read POD std::vector
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, bool> read(std::vector<T>& vec, std::size_t size) const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, bool> read(std::vector<T>& vec, std::size_t size) const
{
vec.resize(size);
return read(vec.data(), sizeof(T) * size) == sizeof(T) * size;
}
// Read POD (experimental)
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, T> read() const
template <typename T>
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, T> read() const
{
T result;
if (!read(result)) xfail();
@@ -360,7 +360,7 @@ namespace fs
// Read full file to std::vector
template<typename T>
std::enable_if_t<std::is_pod<T>::value && !std::is_pointer<T>::value, std::vector<T>> to_vector() const
std::enable_if_t<std::is_trivially_copyable_v<T> && !std::is_pointer_v<T>, std::vector<T>> to_vector() const
{
std::vector<T> result;
result.resize(size() / sizeof(T));
@@ -516,6 +516,8 @@ namespace fs
readonly,
isdir,
toolong,
nospace,
unknown
};
// Error code returned
@@ -597,8 +599,7 @@ namespace fs
const s64 new_pos =
whence == fs::seek_set ? offset :
whence == fs::seek_cur ? offset + pos :
whence == fs::seek_end ? offset + size() :
(fmt::raw_error("fs::container_stream<>::seek(): invalid whence"), 0);
whence == fs::seek_end ? offset + size() : -1;
if (new_pos < 0)
{
+80 -38
View File
@@ -2,7 +2,7 @@
#include "JIT.h"
#include "StrFmt.h"
#include "File.h"
#include "Log.h"
#include "util/logs.hpp"
#include "mutex.h"
#include "sysinfo.h"
#include "VirtualMemory.h"
@@ -14,6 +14,8 @@
#define CAN_OVERCOMMIT
#endif
LOG_CHANNEL(jit_log, "JIT");
static u8* get_jit_memory()
{
// Reserve 2G memory (magic static)
@@ -43,7 +45,7 @@ static u8* add_jit_memory(std::size_t size, uint align)
// Select subrange
u8* pointer = get_jit_memory() + Off;
if (UNLIKELY(!size && !align))
if (!size && !align) [[unlikely]]
{
// Return subrange info
return pointer;
@@ -57,7 +59,7 @@ static u8* add_jit_memory(std::size_t size, uint align)
const u64 _pos = ::align(ctr & 0xffff'ffff, align);
const u64 _new = ::align(_pos + size, align);
if (UNLIKELY(_new > 0x40000000))
if (_new > 0x40000000) [[unlikely]]
{
// Sorry, we failed, and further attempts should fail too.
ctr |= 0x40000000;
@@ -69,7 +71,7 @@ static u8* add_jit_memory(std::size_t size, uint align)
newa = olda;
// Check the necessity to commit more memory
if (UNLIKELY(_new > olda))
if (_new > olda) [[unlikely]]
{
newa = ::align(_new, 0x100000);
}
@@ -78,13 +80,13 @@ static u8* add_jit_memory(std::size_t size, uint align)
return _pos;
});
if (UNLIKELY(pos == -1))
if (pos == umax) [[unlikely]]
{
LOG_WARNING(GENERAL, "JIT: Out of memory (size=0x%x, align=0x%x, off=0x%x)", size, align, Off);
jit_log.warning("JIT: Out of memory (size=0x%x, align=0x%x, off=0x%x)", size, align, Off);
return nullptr;
}
if (UNLIKELY(olda != newa))
if (olda != newa) [[unlikely]]
{
#ifdef CAN_OVERCOMMIT
madvise(pointer + olda, newa - olda, MADV_WILLNEED);
@@ -117,21 +119,21 @@ jit_runtime::~jit_runtime()
asmjit::Error jit_runtime::_add(void** dst, asmjit::CodeHolder* code) noexcept
{
std::size_t codeSize = code->getCodeSize();
if (UNLIKELY(!codeSize))
if (!codeSize) [[unlikely]]
{
*dst = nullptr;
return asmjit::kErrorNoCodeGenerated;
}
void* p = jit_runtime::alloc(codeSize, 16);
if (UNLIKELY(!p))
if (!p) [[unlikely]]
{
*dst = nullptr;
return asmjit::kErrorNoVirtualMemory;
}
std::size_t relocSize = code->relocate(p);
if (UNLIKELY(!relocSize))
if (!relocSize) [[unlikely]]
{
*dst = nullptr;
return asmjit::kErrorInvalidState;
@@ -431,7 +433,7 @@ public:
void reset()
{
if (!m_segs.size())
if (m_segs.empty())
{
if (m_curr.addr != nullptr)
{
@@ -532,7 +534,7 @@ extern void jit_finalize()
{
if (!RtlDeleteFunctionTable(unwind.data()))
{
LOG_FATAL(GENERAL, "RtlDeleteFunctionTable() failed! Error %u", GetLastError());
jit_log.fatal("RtlDeleteFunctionTable() failed! Error %u", GetLastError());
}
}
@@ -579,11 +581,11 @@ struct MemoryManager : llvm::RTDyldMemoryManager
if (addr)
{
LOG_WARNING(GENERAL, "LLVM: Symbol requested: %s -> 0x%016llx", name, addr);
jit_log.warning("LLVM: Symbol requested: %s -> 0x%016llx", name, addr);
}
else
{
LOG_ERROR(GENERAL, "LLVM: Linkage failed: %s", name);
jit_log.error("LLVM: Linkage failed: %s", name);
addr = reinterpret_cast<u64>(null);
}
}
@@ -661,13 +663,13 @@ struct MemoryManager : llvm::RTDyldMemoryManager
if (ptr == nullptr)
{
LOG_FATAL(GENERAL, "LLVM: Out of memory (size=0x%llx, aligned 0x%x)", size, align);
jit_log.fatal("LLVM: Out of memory (size=0x%llx, aligned 0x%x)", size, align);
return nullptr;
}
utils::memory_commit(ptr, size, utils::protection::wx);
m_code_addr = static_cast<u8*>(ptr);
LOG_NOTICE(GENERAL, "LLVM: Code section %u '%s' allocated -> %p (size=0x%llx, aligned 0x%x)", sec_id, sec_name.data(), ptr, size, align);
jit_log.notice("LLVM: Code section %u '%s' allocated -> %p (size=0x%llx, aligned 0x%x)", sec_id, sec_name.data(), ptr, size, align);
return static_cast<u8*>(ptr);
}
@@ -685,7 +687,7 @@ struct MemoryManager : llvm::RTDyldMemoryManager
if (ptr == nullptr)
{
LOG_FATAL(GENERAL, "LLVM: Out of memory (size=0x%llx, aligned 0x%x)", size, align);
jit_log.fatal("LLVM: Out of memory (size=0x%llx, aligned 0x%x)", size, align);
return nullptr;
}
@@ -695,7 +697,7 @@ struct MemoryManager : llvm::RTDyldMemoryManager
utils::memory_commit(ptr, size);
LOG_NOTICE(GENERAL, "LLVM: Data section %u '%s' allocated -> %p (size=0x%llx, aligned 0x%x, %s)", sec_id, sec_name.data(), ptr, size, align, is_ro ? "ro" : "rw");
jit_log.notice("LLVM: Data section %u '%s' allocated -> %p (size=0x%llx, aligned 0x%x, %s)", sec_id, sec_name.data(), ptr, size, align, is_ro ? "ro" : "rw");
return static_cast<u8*>(ptr);
}
@@ -718,9 +720,9 @@ struct MemoryManager : llvm::RTDyldMemoryManager
void registerEHFrames(u8* addr, u64 load_addr, std::size_t size) override
{
#ifdef _WIN32
// Lock memory manager
std::lock_guard lock(s_mutex);
#ifdef _WIN32
// Fix RUNTIME_FUNCTION records (.pdata section)
decltype(s_unwater)::value_type pdata_entry = std::move(s_unwater.front());
s_unwater.pop_front();
@@ -738,7 +740,7 @@ struct MemoryManager : llvm::RTDyldMemoryManager
// Register .xdata UNWIND_INFO structs
if (!RtlAddFunctionTable(pdata.data(), (DWORD)pdata.size(), segment_start))
{
LOG_ERROR(GENERAL, "RtlAddFunctionTable() failed! Error %u", GetLastError());
jit_log.error("RtlAddFunctionTable() failed! Error %u", GetLastError());
}
else
{
@@ -784,7 +786,11 @@ struct MemoryManager2 : llvm::RTDyldMemoryManager
{
#ifndef _WIN32
RTDyldMemoryManager::registerEHFramesInProcess(addr, size);
s_unfire.push_front(std::make_pair(addr, size));
{
// Lock memory manager
std::lock_guard lock(s_mutex);
s_unfire.push_front(std::make_pair(addr, size));
}
#endif
}
@@ -909,20 +915,24 @@ public:
~ObjectCache() override = default;
void notifyObjectCompiled(const llvm::Module* module, llvm::MemoryBufferRef obj) override
void notifyObjectCompiled(const llvm::Module* _module, llvm::MemoryBufferRef obj) override
{
std::string name = m_path;
name.append(module->getName());
name.append(_module->getName().data());
//fs::file(name, fs::rewrite).write(obj.getBufferStart(), obj.getBufferSize());
name.append(".gz");
z_stream zs{};
uLong zsz = compressBound(obj.getBufferSize()) + 256;
uLong zsz = compressBound(::narrow<u32>(obj.getBufferSize(), HERE)) + 256;
auto zbuf = std::make_unique<uchar[]>(zsz);
#ifndef _MSC_VER
#pragma GCC diagnostic push
#pragma GCC diagnostic ignored "-Wold-style-cast"
#endif
deflateInit2(&zs, 9, Z_DEFLATED, 16 + 15, 9, Z_DEFAULT_STRATEGY);
#ifndef _MSC_VER
#pragma GCC diagnostic pop
#endif
zs.avail_in = static_cast<uInt>(obj.getBufferSize());
zs.next_in = reinterpret_cast<uchar*>(const_cast<char*>(obj.getBufferStart()));
zs.avail_out = static_cast<uInt>(zsz);
@@ -938,14 +948,14 @@ public:
}
default:
{
LOG_ERROR(GENERAL, "LLVM: Failed to compress module: %s", module->getName().data());
jit_log.error("LLVM: Failed to compress module: %s", _module->getName().data());
deflateEnd(&zs);
return;
}
}
fs::file(name, fs::rewrite).write(zbuf.get(), zsz - zs.avail_out);
LOG_NOTICE(GENERAL, "LLVM: Created module: %s", module->getName().data());
jit_log.notice("LLVM: Created module: %s", _module->getName().data());
}
static std::unique_ptr<llvm::MemoryBuffer> load(const std::string& path)
@@ -955,10 +965,19 @@ public:
std::vector<uchar> gz = cached.to_vector<uchar>();
std::vector<uchar> out;
z_stream zs{};
if (gz.empty()) [[unlikely]]
{
return nullptr;
}
#ifndef _MSC_VER
#pragma GCC diagnostic push
#pragma GCC diagnostic ignored "-Wold-style-cast"
#endif
inflateInit2(&zs, 16 + 15);
#ifndef _MSC_VER
#pragma GCC diagnostic pop
#endif
zs.avail_in = static_cast<uInt>(gz.size());
zs.next_in = gz.data();
out.resize(gz.size() * 6);
@@ -1001,6 +1020,11 @@ public:
if (fs::file cached{path, fs::read})
{
if (cached.size() == 0) [[unlikely]]
{
return nullptr;
}
auto buf = llvm::WritableMemoryBuffer::getNewUninitMemBuffer(cached.size());
cached.read(buf->getBufferStart(), buf->getBufferSize());
return buf;
@@ -1009,14 +1033,14 @@ public:
return nullptr;
}
std::unique_ptr<llvm::MemoryBuffer> getObject(const llvm::Module* module) override
std::unique_ptr<llvm::MemoryBuffer> getObject(const llvm::Module* _module) override
{
std::string path = m_path;
path.append(module->getName());
path.append(_module->getName().data());
if (auto buf = load(path))
{
LOG_NOTICE(GENERAL, "LLVM: Loaded module: %s", module->getName().data());
jit_log.notice("LLVM: Loaded module: %s", _module->getName().data());
return buf;
}
@@ -1030,7 +1054,7 @@ std::string jit_compiler::cpu(const std::string& _cpu)
if (m_cpu.empty())
{
m_cpu = llvm::sys::getHostCPUName();
m_cpu = llvm::sys::getHostCPUName().operator std::string();
if (m_cpu == "sandybridge" ||
m_cpu == "ivybridge" ||
@@ -1063,7 +1087,7 @@ std::string jit_compiler::cpu(const std::string& _cpu)
m_cpu == "tigerlake")
{
// Downgrade if AVX-512 is disabled or not supported
if (!utils::has_512())
if (!utils::has_avx512())
{
m_cpu = "skylake";
}
@@ -1142,13 +1166,13 @@ jit_compiler::~jit_compiler()
{
}
void jit_compiler::add(std::unique_ptr<llvm::Module> module, const std::string& path)
void jit_compiler::add(std::unique_ptr<llvm::Module> _module, const std::string& path)
{
ObjectCache cache{path};
m_engine->setObjectCache(&cache);
const auto ptr = module.get();
m_engine->addModule(std::move(module));
const auto ptr = _module.get();
m_engine->addModule(std::move(_module));
m_engine->generateCodeForModule(ptr);
m_engine->setObjectCache(nullptr);
@@ -1159,10 +1183,10 @@ void jit_compiler::add(std::unique_ptr<llvm::Module> module, const std::string&
}
}
void jit_compiler::add(std::unique_ptr<llvm::Module> module)
void jit_compiler::add(std::unique_ptr<llvm::Module> _module)
{
const auto ptr = module.get();
m_engine->addModule(std::move(module));
const auto ptr = _module.get();
m_engine->addModule(std::move(_module));
m_engine->generateCodeForModule(ptr);
for (auto& func : ptr->functions())
@@ -1182,10 +1206,28 @@ void jit_compiler::add(const std::string& path)
}
else
{
LOG_ERROR(GENERAL, "ObjectCache: Adding failed: %s", path);
jit_log.error("ObjectCache: Adding failed: %s", path);
}
}
bool jit_compiler::check(const std::string& path)
{
if (auto cache = ObjectCache::load(path))
{
if (auto object_file = llvm::object::ObjectFile::createObjectFile(*cache))
{
return true;
}
if (fs::remove_file(path))
{
jit_log.error("ObjectCache: Removed damaged file: %s", path);
}
}
return false;
}
void jit_compiler::fin()
{
m_engine->finalizeObject();
+5 -2
View File
@@ -163,14 +163,17 @@ public:
}
// Add module (path to obj cache dir)
void add(std::unique_ptr<llvm::Module> module, const std::string& path);
void add(std::unique_ptr<llvm::Module> _module, const std::string& path);
// Add module (not cached)
void add(std::unique_ptr<llvm::Module> module);
void add(std::unique_ptr<llvm::Module> _module);
// Add object (path to obj file)
void add(const std::string& path);
// Check object file
static bool check(const std::string& path);
// Finalize
void fin();
-123
View File
@@ -1,123 +0,0 @@
#pragma once
#include "types.h"
#include "util/atomic.hpp"
#include "StrFmt.h"
#include <climits>
namespace logs
{
enum class level : uint
{
always, // Highest log severity (unused, cannot be disabled)
fatal,
error,
todo,
success,
warning,
notice,
trace, // Lowest severity (usually disabled)
_uninit = UINT_MAX, // Special value for delayed initialization
};
struct channel;
// Message information
struct message
{
channel* ch;
level sev;
private:
// Send log message to global logger instance
void broadcast(const char*, const fmt_type_info*, ...) const;
friend struct channel;
};
class listener
{
// Next listener (linked list)
atomic_t<listener*> m_next{};
friend struct message;
public:
constexpr listener() = default;
virtual ~listener();
// Process log message
virtual void log(u64 stamp, const message& msg, const std::string& prefix, const std::string& text) = 0;
// Add new listener
static void add(listener*);
};
struct channel
{
// Channel prefix (added to every log message)
const char* const name;
// The lowest logging level enabled for this channel (used for early filtering)
atomic_t<level> enabled;
// Constant initialization: channel name
constexpr channel(const char* name)
: name(name)
, enabled(level::_uninit)
{
}
#define GEN_LOG_METHOD(_sev)\
const message msg_##_sev{this, level::_sev};\
template <std::size_t N, typename... Args>\
void _sev(const char(&fmt)[N], const Args&... args)\
{\
if (UNLIKELY(level::_sev <= enabled))\
{\
static constexpr fmt_type_info type_list[sizeof...(Args) + 1]{fmt_type_info::make<fmt_unveil_t<Args>>()...};\
msg_##_sev.broadcast(fmt, type_list, u64{fmt_unveil<Args>::get(args)}...);\
}\
}
GEN_LOG_METHOD(fatal)
GEN_LOG_METHOD(error)
GEN_LOG_METHOD(todo)
GEN_LOG_METHOD(success)
GEN_LOG_METHOD(warning)
GEN_LOG_METHOD(notice)
GEN_LOG_METHOD(trace)
#undef GEN_LOG_METHOD
};
/* Small set of predefined channels */
extern channel GENERAL;
extern channel LOADER;
extern channel MEMORY;
extern channel RSX;
extern channel HLE;
extern channel PPU;
extern channel SPU;
// Log level control: set all channels to level::notice
void reset();
// Log level control: register channel if necessary, set channel level
void set_level(const std::string&, level);
}
#define LOG_CHANNEL(ch, ...) ::logs::channel ch(#ch, ##__VA_ARGS__)
// Legacy:
#define LOG_SUCCESS(ch, fmt, ...) logs::ch.success("" fmt, ##__VA_ARGS__)
#define LOG_NOTICE(ch, fmt, ...) logs::ch.notice ("" fmt, ##__VA_ARGS__)
#define LOG_WARNING(ch, fmt, ...) logs::ch.warning("" fmt, ##__VA_ARGS__)
#define LOG_ERROR(ch, fmt, ...) logs::ch.error ("" fmt, ##__VA_ARGS__)
#define LOG_TODO(ch, fmt, ...) logs::ch.todo ("" fmt, ##__VA_ARGS__)
#define LOG_TRACE(ch, fmt, ...) logs::ch.trace ("" fmt, ##__VA_ARGS__)
#define LOG_FATAL(ch, fmt, ...) logs::ch.fatal ("" fmt, ##__VA_ARGS__)
+50 -7
View File
@@ -1,10 +1,12 @@
#include "StrFmt.h"
#include "StrFmt.h"
#include "BEType.h"
#include "StrUtil.h"
#include "cfmt.h"
#include "util/logs.hpp"
#include <algorithm>
#include <string_view>
#include "Thread.h"
#ifdef _WIN32
#include <Windows.h>
@@ -12,6 +14,47 @@
#include <errno.h>
#endif
#ifdef _WIN32
std::string wchar_to_utf8(wchar_t *src)
{
std::string utf8_string;
const auto tmp_size = WideCharToMultiByte(CP_UTF8, 0, src, -1, nullptr, 0, nullptr, nullptr);
utf8_string.resize(tmp_size);
WideCharToMultiByte(CP_UTF8, 0, src, -1, utf8_string.data(), tmp_size, nullptr, nullptr);
return utf8_string;
}
std::string wchar_path_to_ansi_path(const std::wstring& src)
{
std::wstring buf_short;
std::string buf_final;
// Get the short path from the wide char path(short path should only contain ansi characters)
auto tmp_size = GetShortPathNameW(src.data(), nullptr, 0);
buf_short.resize(tmp_size);
GetShortPathNameW(src.data(), buf_short.data(), tmp_size);
// Convert wide char to ansi
tmp_size = WideCharToMultiByte(CP_ACP, 0, buf_short.data(), -1, nullptr, 0, nullptr, nullptr);
buf_final.resize(tmp_size);
WideCharToMultiByte(CP_ACP, 0, buf_short.data(), -1, buf_final.data(), tmp_size, nullptr, nullptr);
return buf_final;
}
std::string utf8_path_to_ansi_path(const std::string& src)
{
std::wstring buf_wide;
// Converts the utf-8 path to wide char
const auto tmp_size = MultiByteToWideChar(CP_UTF8, 0, src.c_str(), -1, nullptr, 0);
buf_wide.resize(tmp_size);
MultiByteToWideChar(CP_UTF8, 0, src.c_str(), -1, buf_wide.data(), tmp_size);
return wchar_path_to_ansi_path(buf_wide);
}
#endif
template <>
void fmt_class_string<std::pair<const fmt_type_info*, u64>>::format(std::string& out, u64 arg)
{
@@ -203,7 +246,7 @@ namespace fmt
{
void raw_error(const char* msg)
{
throw std::runtime_error{msg};
thread_ctrl::emergency_exit(msg);
}
void raw_verify_error(const char* msg, const fmt_type_info* sup, u64 arg)
@@ -236,7 +279,7 @@ namespace fmt
out += msg;
}
throw std::runtime_error{out};
thread_ctrl::emergency_exit(out);
}
void raw_narrow_error(const char* msg, const fmt_type_info* sup, u64 arg)
@@ -256,14 +299,14 @@ namespace fmt
out += msg;
}
throw std::range_error{out};
thread_ctrl::emergency_exit(out);
}
void raw_throw_exception(const char* fmt, const fmt_type_info* sup, const u64* args)
{
std::string out;
raw_append(out, fmt, sup, args);
throw std::runtime_error{out};
thread_ctrl::emergency_exit(out);
}
struct cfmt_src;
@@ -342,7 +385,7 @@ std::string fmt::replace_first(const std::string& src, const std::string& from,
{
auto pos = src.find(from);
if (pos == std::string::npos)
if (pos == umax)
{
return src;
}
@@ -353,7 +396,7 @@ std::string fmt::replace_first(const std::string& src, const std::string& from,
std::string fmt::replace_all(const std::string& src, const std::string& from, const std::string& to)
{
std::string target = src;
for (auto pos = target.find(from); pos != std::string::npos; pos = target.find(from, pos + 1))
for (auto pos = target.find(from); pos != umax; pos = target.find(from, pos + 1))
{
target = (pos ? target.substr(0, pos) + to : to) + std::string(target.c_str() + pos + from.length());
pos += to.length();
+8 -8
View File
@@ -8,8 +8,8 @@
namespace fmt
{
template <typename... Args>
static std::string format(const char*, const Args&...);
template <typename CharT, std::size_t N, typename... Args>
static std::string format(const CharT(&)[N], const Args&...);
}
template <typename T, typename>
@@ -274,19 +274,19 @@ namespace fmt
void raw_append(std::string& out, const char*, const fmt_type_info*, const u64*) noexcept;
// Formatting function
template <typename... Args>
SAFE_BUFFERS FORCE_INLINE void append(std::string& out, const char* fmt, const Args&... args)
template <typename CharT, std::size_t N, typename... Args>
SAFE_BUFFERS FORCE_INLINE void append(std::string& out, const CharT(&fmt)[N], const Args&... args)
{
static constexpr fmt_type_info type_list[sizeof...(Args) + 1]{fmt_type_info::make<fmt_unveil_t<Args>>()...};
raw_append(out, fmt, type_list, fmt_args_t<Args...>{fmt_unveil<Args>::get(args)...});
raw_append(out, reinterpret_cast<const char*>(fmt), type_list, fmt_args_t<Args...>{fmt_unveil<Args>::get(args)...});
}
// Formatting function
template <typename... Args>
SAFE_BUFFERS FORCE_INLINE std::string format(const char* fmt, const Args&... args)
template <typename CharT, std::size_t N, typename... Args>
SAFE_BUFFERS FORCE_INLINE std::string format(const CharT(&fmt)[N], const Args&... args)
{
std::string result;
append<Args...>(result, fmt, args...);
append(result, fmt, args...);
return result;
}
+12 -21
View File
@@ -7,28 +7,19 @@
#include <functional>
#include <string_view>
// Copy null-terminated string from std::string to char array with truncation
template <std::size_t N>
inline void strcpy_trunc(char (&dst)[N], const std::string& src)
{
const std::size_t count = src.size() >= N ? N - 1 : src.size();
std::memcpy(dst, src.c_str(), count);
std::memset(dst + count, 0, N - count);
}
#ifdef _WIN32
std::string wchar_to_utf8(wchar_t *src);
std::string wchar_path_to_ansi_path(const std::wstring& src);
std::string utf8_path_to_ansi_path(const std::string& src);
#endif
// Copy null-terminated string from char array to another char array with truncation
template <std::size_t N, std::size_t N2>
inline void strcpy_trunc(char (&dst)[N], const char (&src)[N2])
// Copy null-terminated string from a std::string or a char array to a char array with truncation
template <typename D, typename T>
inline void strcpy_trunc(D& dst, const T& src)
{
const std::size_t count = N2 >= N ? N - 1 : N2;
std::memcpy(dst, src, count);
std::memset(dst + count, 0, N - count);
}
template <std::size_t N>
inline bool ends_with(const std::string& src, const char (&end)[N])
{
return src.size() >= N - 1 && src.compare(src.size() - (N - 1), N - 1, end, N - 1) == 0;
const std::size_t count = std::size(src) >= std::size(dst) ? std::size(dst) - 1 : std::size(src);
std::memcpy(std::data(dst), std::data(src), count);
std::memset(std::data(dst) + count, 0, std::size(dst) - count);
}
namespace fmt
@@ -90,7 +81,7 @@ namespace fmt
template <typename T>
std::string merge(const T& source, const std::string& separator)
{
if (!source.size())
if (source.empty())
{
return {};
}
+537 -234
View File
File diff suppressed because it is too large Load Diff
+175 -133
View File
@@ -2,6 +2,7 @@
#include "types.h"
#include "util/atomic.hpp"
#include "util/shared_cptr.hpp"
#include <string>
#include <memory>
@@ -14,9 +15,6 @@
// Report error and call std::abort(), defined in main.cpp
[[noreturn]] void report_fatal_error(const std::string&);
// Will report exception and call std::abort() if put in catch(...)
[[noreturn]] void catch_all_exceptions();
// Hardware core layout
enum class native_core_arrangement : u32
{
@@ -37,8 +35,8 @@ enum class thread_class : u32
enum class thread_state : u32
{
created, // Initial state
detached, // The thread has been detached to destroy its own named_thread object (can be dangerously misused)
aborting, // The thread has been joined in the destructor or explicitly aborted (mutually exclusive with detached)
aborting, // The thread has been joined in the destructor or explicitly aborted
errored, // Set after the emergency_exit call
finished // Final state, always set at the end of thread execution
};
@@ -48,6 +46,8 @@ class named_thread;
template <typename T>
struct result_storage
{
static_assert(std::is_default_constructible_v<T> && noexcept(T()));
alignas(T) std::byte data[sizeof(T)];
static constexpr bool empty = false;
@@ -81,27 +81,6 @@ struct result_storage<void>
template <class Context, typename... Args>
using result_storage_t = result_storage<std::invoke_result_t<Context, Args...>>;
// Detect on_abort() method (should return void)
template <typename T, typename = void>
struct thread_on_abort : std::bool_constant<false> {};
template <typename T>
struct thread_on_abort<T, decltype(std::declval<named_thread<T>&>().on_abort())> : std::bool_constant<true> {};
// Detect on_cleanup() static member function (should return void) (in C++20 can use destroying delete instead)
template <typename T, typename = void>
struct thread_on_cleanup : std::bool_constant<false> {};
template <typename T>
struct thread_on_cleanup<T, decltype(named_thread<T>::on_cleanup(std::declval<named_thread<T>*>()))> : std::bool_constant<true> {};
// Detect on_wait() method (should return bool)
template <typename T, typename = bool>
struct thread_on_wait : std::bool_constant<false> {};
template <typename T>
struct thread_on_wait<T, decltype(std::declval<named_thread<T>&>().on_wait())> : std::bool_constant<true> {};
template <typename T, typename = void>
struct thread_thread_name : std::bool_constant<false> {};
@@ -118,21 +97,10 @@ class thread_base
using native_entry = void*(*)(void* arg);
#endif
#ifdef __linux__
// Linux thread timer
int m_timer = -1;
#endif
// Thread handle (platform-specific)
atomic_t<std::uintptr_t> m_thread{0};
// Thread mutex
mutable shared_mutex m_mutex;
// Thread condition variable
cond_variable m_cond;
// Thread flags
// Thread playtoy, that shouldn't be used
atomic_t<u32> m_signal{0};
// Thread state
@@ -142,7 +110,7 @@ class thread_base
atomic_t<const void*> m_state_notifier{nullptr};
// Thread name
lf_value<std::string> m_name;
stx::atomic_cptr<std::string> m_tname;
//
atomic_t<u64> m_cycles = 0;
@@ -151,13 +119,13 @@ class thread_base
void start(native_entry);
// Called at the thread start
void initialize(bool(*wait_cb)(const void*));
void initialize(void (*error_cb)(), bool(*wait_cb)(const void*));
// May be called in destructor
void notify_abort() noexcept;
// Called at the thread end, returns true if needs destruction
bool finalize(int) noexcept;
bool finalize(thread_state result) noexcept;
// Cleanup after possibly deleting the thread instance
static void finalize() noexcept;
@@ -177,7 +145,7 @@ public:
u64 get_cycles();
// Wait for the thread (it does NOT change thread state, and can be called from multiple threads)
void join() const;
bool join() const;
// Notify the thread
void notify();
@@ -189,6 +157,9 @@ class thread_ctrl final
// Current thread
static thread_local thread_base* g_tls_this_thread;
// Error handling details
static thread_local void(*g_tls_error_callback)();
// Target cpu core layout
static atomic_t<native_core_arrangement> g_native_core_layout;
@@ -197,31 +168,34 @@ class thread_ctrl final
friend class thread_base;
// Optimized get_name() for logging
static std::string get_name_cached();
public:
// Get current thread name
static std::string_view get_name()
static std::string get_name()
{
return g_tls_this_thread->m_name.get();
return *g_tls_this_thread->m_tname.load();
}
// Get thread name
template <typename T>
static std::string_view get_name(const named_thread<T>& thread)
static std::string get_name(const named_thread<T>& thread)
{
return static_cast<const thread_base&>(thread).m_name.get();
return *static_cast<const thread_base&>(thread).m_tname.load();
}
// Set current thread name (not recommended)
static void set_name(std::string_view name)
{
g_tls_this_thread->m_name.assign(name);
g_tls_this_thread->m_tname.store(stx::shared_cptr<std::string>::make(name));
}
// Set thread name (not recommended)
template <typename T>
static void set_name(named_thread<T>& thread, std::string_view name)
{
static_cast<thread_base&>(thread).m_name.assign(name);
static_cast<thread_base&>(thread).m_tname.store(stx::shared_cptr<std::string>::make(name));
}
template <typename T>
@@ -236,6 +210,12 @@ public:
static_cast<thread_base&>(thread).notify();
}
template <typename T>
static void raw_notify(named_thread<T>& thread)
{
static_cast<thread_base&>(thread).notify_abort();
}
// Read current state
static inline thread_state state()
{
@@ -254,20 +234,8 @@ public:
_wait_for(-1, true);
}
// Wait until pred().
template <typename F, typename RT = std::invoke_result_t<F>>
static inline RT wait(F&& pred)
{
while (true)
{
if (RT result = pred())
{
return result;
}
_wait_for(-1, true);
}
}
// Exit.
[[noreturn]] static void emergency_exit(std::string_view reason);
// Get current thread (may be nullptr)
static thread_base* get_current()
@@ -287,12 +255,15 @@ public:
// Sets the preferred affinity mask for this thread
static void set_thread_affinity_mask(u64 mask);
// Spawn a detached named thread
template <typename F>
[[deprecated]] static void spawn(std::string_view name, F&& func)
{
new named_thread<F>(thread_state::detached, name, std::forward<F>(func));
}
// Get process affinity mask
static u64 get_process_affinity_mask();
// Miscellaneous
static u64 get_thread_affinity_mask();
private:
// Miscellaneous
static const u64 process_affinity_mask;
};
// Derived from the callable object Context, possibly a lambda
@@ -304,9 +275,9 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
// Type-erased thread entry point
#ifdef _WIN32
static inline uint __stdcall entry_point(void* arg) try
static inline uint __stdcall entry_point(void* arg)
#else
static inline void* entry_point(void* arg) try
static inline void* entry_point(void* arg)
#endif
{
const auto _this = static_cast<named_thread*>(static_cast<thread*>(arg));
@@ -314,28 +285,25 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
// Perform self-cleanup if necessary
if (_this->entry_point())
{
// Call on_cleanup() static member function if it's available
if constexpr (thread_on_cleanup<Context>())
{
Context::on_cleanup(_this);
}
else
{
delete _this;
}
delete _this;
}
thread::finalize();
return 0;
}
catch (...)
{
catch_all_exceptions();
}
bool entry_point()
{
thread::initialize([](const void* data)
auto tls_error_cb = []()
{
if constexpr (!result::empty)
{
// Construct using default constructor in the case of failure
new (static_cast<result*>(static_cast<named_thread*>(thread_ctrl::get_current()))->get()) typename result::type();
}
};
thread::initialize(tls_error_cb, [](const void* data)
{
const auto _this = thread_ctrl::get_current();
@@ -344,14 +312,6 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
return false;
}
if constexpr (thread_on_wait<Context>())
{
if (!static_cast<named_thread*>(_this)->on_wait())
{
return false;
}
}
_this->m_state_notifier.release(data);
if (!data)
@@ -365,15 +325,6 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
return false;
}
if constexpr (thread_on_wait<Context>())
{
if (!static_cast<named_thread*>(_this)->on_wait())
{
_this->m_state_notifier.release(nullptr);
return false;
}
}
return true;
});
@@ -388,38 +339,17 @@ class named_thread final : public Context, result_storage_t<Context>, thread_bas
new (result::get()) typename result::type(Context::operator()());
}
return thread::finalize(0);
}
static decltype(auto) get_default_thread_name()
{
if constexpr (thread_thread_name<Context>())
{
return Context::thread_name;
}
else
{
return "Unnamed Thread";
}
}
// Detached thread constructor
named_thread(thread_state s, std::string_view name, Context&& f)
: Context(std::forward<Context>(f))
, thread(name)
{
thread::m_state.raw() = s;
thread::start(&named_thread::entry_point);
return thread::finalize(thread_state::finished);
}
friend class thread_ctrl;
public:
// Default constructor
template <bool Valid = std::is_default_constructible_v<Context>, typename = std::enable_if_t<Valid>>
template <bool Valid = std::is_default_constructible_v<Context> && thread_thread_name<Context>(), typename = std::enable_if_t<Valid>>
named_thread()
: Context()
, thread(get_default_thread_name())
, thread(Context::thread_name)
{
thread::start(&named_thread::entry_point);
}
@@ -473,19 +403,15 @@ public:
return thread::m_state.load();
}
// Try to abort/detach
// Try to abort by assigning thread_state::aborting (UB if assigning different state)
named_thread& operator=(thread_state s)
{
if (s < thread_state::finished && thread::m_state.compare_and_swap_test(thread_state::created, s))
ASSUME(s == thread_state::aborting);
if (s == thread_state::aborting && thread::m_state.compare_and_swap_test(thread_state::created, s))
{
if (s == thread_state::aborting)
{
// Call on_abort() method if it's available
if constexpr (thread_on_abort<Context>())
{
Context::on_abort();
}
thread::notify_abort();
}
}
@@ -496,6 +422,7 @@ public:
// Context type doesn't need virtual destructor
~named_thread()
{
// Assign aborting state forcefully
operator=(thread_state::aborting);
thread::join();
@@ -505,3 +432,118 @@ public:
}
}
};
// Group of named threads, similar to named_thread
template <class Context>
class named_thread_group final
{
using Thread = named_thread<Context>;
const u32 m_count;
Thread* m_threads;
void init_threads()
{
m_threads = static_cast<Thread*>(::operator new(sizeof(Thread) * m_count, std::align_val_t{alignof(Thread)}));
}
public:
// Lambda constructor, also the implicit deduction guide candidate
named_thread_group(std::string_view name, u32 count, const Context& f)
: m_count(count)
, m_threads(nullptr)
{
if (count == 0)
{
return;
}
init_threads();
// Create all threads
for (u32 i = 0; i < m_count; i++)
{
new (static_cast<void*>(m_threads + i)) Thread(std::string(name) + std::to_string(i + 1), f);
}
}
// Default constructor
named_thread_group(std::string_view name, u32 count)
: m_count(count)
, m_threads(nullptr)
{
if (count == 0)
{
return;
}
init_threads();
// Create all threads
for (u32 i = 0; i < m_count; i++)
{
new (static_cast<void*>(m_threads + i)) Thread(std::string(name) + std::to_string(i + 1));
}
}
named_thread_group(const named_thread_group&) = delete;
named_thread_group& operator=(const named_thread_group&) = delete;
// Wait for completion
bool join() const
{
bool result = true;
for (u32 i = 0; i < m_count; i++)
{
std::as_const(*std::launder(m_threads + i))();
if (std::as_const(*std::launder(m_threads + i)) != thread_state::finished)
result = false;
}
return result;
}
// Join and access specific thread
auto operator[](u32 index) const
{
return std::as_const(*std::launder(m_threads + index))();
}
// Join and access specific thread
auto operator[](u32 index)
{
return (*std::launder(m_threads + index))();
}
// Dumb iterator
auto begin()
{
return std::launder(m_threads);
}
// Dumb iterator
auto end()
{
return m_threads + m_count;
}
u32 size() const
{
return m_count;
}
~named_thread_group()
{
// Destroy all threads (it should join them)
for (u32 i = 0; i < m_count; i++)
{
std::launder(m_threads + i)->~Thread();
}
::operator delete(static_cast<void*>(m_threads), std::align_val_t{alignof(Thread)});
}
};
+29 -3
View File
@@ -1,5 +1,5 @@
#include "stdafx.h"
#include "Utilities/Log.h"
#include "util/logs.hpp"
#include "VirtualMemory.h"
#ifdef _WIN32
#include <Windows.h>
@@ -63,6 +63,17 @@ namespace utils
#ifdef _WIN32
return ::VirtualAlloc(use_addr, size, MEM_RESERVE, PAGE_NOACCESS);
#else
if (use_addr && reinterpret_cast<uptr>(use_addr) % 0x10000)
{
return nullptr;
}
if (!use_addr)
{
// Hack: Ensure aligned 64k allocations
size += 0x10000;
}
auto ptr = ::mmap(use_addr, size, PROT_NONE, MAP_ANON | MAP_PRIVATE, -1, 0);
if (ptr == reinterpret_cast<void*>(-1))
@@ -76,6 +87,20 @@ namespace utils
return nullptr;
}
if (!use_addr && ptr)
{
// Continuation of the hack above
const auto misalign = reinterpret_cast<uptr>(ptr) % 0x10000;
::munmap(ptr, 0x10000 - misalign);
if (misalign)
{
::munmap(static_cast<u8*>(ptr) + size - misalign, misalign);
}
ptr = static_cast<u8*>(ptr) + (0x10000 - misalign);
}
return ptr;
#endif
}
@@ -141,8 +166,9 @@ namespace utils
#endif
}
shm::shm(u32 size)
shm::shm(u32 size, u32 flags)
: m_size(::align(size, 0x10000))
, m_flags(flags)
{
#ifdef _WIN32
m_handle = ::CreateFileMappingW(INVALID_HANDLE_VALUE, NULL, PAGE_EXECUTE_READWRITE, 0, m_size, NULL);
@@ -154,7 +180,7 @@ namespace utils
#else
while ((m_file = ::shm_open("/rpcs3-mem1", O_RDWR | O_CREAT | O_EXCL, S_IWUSR | S_IRUSR)) == -1)
{
if (m_file == -1 && errno == EMFILE)
if (errno == EMFILE)
{
fmt::throw_exception("Too many open files. Raise the limit and try again.");
}
+8 -1
View File
@@ -48,9 +48,10 @@ namespace utils
int m_file;
#endif
u32 m_size;
u32 m_flags;
public:
explicit shm(u32 size);
explicit shm(u32 size, u32 flags = 0);
shm(const shm&) = delete;
@@ -74,5 +75,11 @@ namespace utils
{
return m_size;
}
// Flags are unspecified, consider it userdata
u32 flags() const
{
return m_flags;
}
};
}
+13 -10
View File
@@ -60,21 +60,26 @@ namespace utils
return (start1 >= start2 && end1 <= end2);
}
address_range(u32 _start, u32 _end) : start(_start), end(_end) {}
constexpr address_range(u32 _start, u32 _end) : start(_start), end(_end) {}
public:
// Constructors
address_range() = default;
address_range(const address_range &other) : start(other.start), end(other.end) {}
constexpr address_range() = default;
constexpr address_range(const address_range &other) : start(other.start), end(other.end) {}
static inline address_range start_length(u32 _start, u32 _length)
static constexpr address_range start_length(u32 _start, u32 _length)
{
return address_range(_start, _start + (_length - 1));
if (!_length)
{
return {};
}
return {_start, _start + (_length - 1)};
}
static inline address_range start_end(u32 _start, u32 _end)
static constexpr address_range start_end(u32 _start, u32 _end)
{
return address_range(_start, _end);
return {_start, _end};
}
// Length
@@ -176,9 +181,7 @@ namespace utils
void set_min_max(const address_range &other)
{
const address_range _range = get_min_max(other);
start = _range.start;
end = _range.end;
*this = get_min_max(other);
}
bool is_page_range() const
-65
View File
@@ -4,71 +4,6 @@
namespace utils
{
inline u32 cntlz32(u32 arg, bool nonzero = false)
{
#ifdef _MSC_VER
ulong res;
return _BitScanReverse(&res, arg) || nonzero ? res ^ 31 : 32;
#elif __LZCNT__
return _lzcnt_u32(arg);
#else
return arg || nonzero ? __builtin_clz(arg) : 32;
#endif
}
inline u64 cntlz64(u64 arg, bool nonzero = false)
{
#ifdef _MSC_VER
ulong res;
return _BitScanReverse64(&res, arg) || nonzero ? res ^ 63 : 64;
#elif __LZCNT__
return _lzcnt_u64(arg);
#else
return arg || nonzero ? __builtin_clzll(arg) : 64;
#endif
}
inline u32 cnttz32(u32 arg, bool nonzero = false)
{
#ifdef _MSC_VER
ulong res;
return _BitScanForward(&res, arg) || nonzero ? res : 32;
#elif __BMI__
return _tzcnt_u32(arg);
#else
return arg || nonzero ? __builtin_ctz(arg) : 32;
#endif
}
inline u64 cnttz64(u64 arg, bool nonzero = false)
{
#ifdef _MSC_VER
ulong res;
return _BitScanForward64(&res, arg) || nonzero ? res : 64;
#elif __BMI__
return _tzcnt_u64(arg);
#else
return arg || nonzero ? __builtin_ctzll(arg) : 64;
#endif
}
inline u8 popcnt32(u32 arg)
{
#ifdef _MSC_VER
const u32 a1 = arg & 0x55555555;
const u32 a2 = (arg >> 1) & 0x55555555;
const u32 a3 = a1 + a2;
const u32 b1 = a3 & 0x33333333;
const u32 b2 = (a3 >> 2) & 0x33333333;
const u32 b3 = b1 + b2;
const u32 c3 = (b3 + (b3 >> 4)) & 0x0f0f0f0f;
const u32 d3 = c3 + (c3 >> 8);
return static_cast<u8>(d3 + (d3 >> 16));
#else
return __builtin_popcount(arg);
#endif
}
// Rotate helpers
#if defined(__GNUG__)
+1089 -93
View File
File diff suppressed because it is too large Load Diff
+122 -11
View File
@@ -1,12 +1,30 @@
#pragma once
#pragma once
#include "BEType.h"
#include <vector>
#include <string>
#include <unordered_map>
#include "util/yaml.hpp"
namespace patch_key
{
static const std::string all = "All";
static const std::string anchors = "Anchors";
static const std::string author = "Author";
static const std::string games = "Games";
static const std::string group = "Group";
static const std::string notes = "Notes";
static const std::string patch = "Patch";
static const std::string patch_version = "Patch Version";
static const std::string version = "Version";
}
static const std::string patch_engine_version = "1.2";
enum class patch_type
{
invalid,
load,
byte,
le16,
@@ -23,20 +41,113 @@ enum class patch_type
class patch_engine
{
struct patch
public:
struct patch_data
{
patch_type type;
u32 offset;
u64 value;
patch_type type = patch_type::load;
u32 offset = 0;
std::string original_value; // Used for import consistency (avoid rounding etc.)
union
{
u64 long_value;
f64 double_value;
} value { 0 };
};
using patch_app_versions = std::unordered_map<std::string /*app_version*/, bool /*enabled*/>;
using patch_serials = std::unordered_map<std::string /*serial*/, patch_app_versions>;
using patch_titles = std::unordered_map<std::string /*serial*/, patch_serials>;
struct patch_info
{
// Patch information
std::vector<patch_data> data_list;
patch_titles titles;
std::string description;
std::string patch_version;
std::string patch_group;
std::string author;
std::string notes;
std::string source_path;
// Redundant information for accessibility (see patch_container)
std::string hash;
std::string version;
bool is_legacy = false;
bool is_enabled = false; // only for legacy patches
};
// Database
std::unordered_map<std::string, std::vector<patch>> m_map;
struct patch_container
{
std::unordered_map<std::string /*description*/, patch_info> patch_info_map;
std::string hash;
std::string version;
bool is_legacy = false;
};
public:
// Load from file
void append(const std::string& path);
using patch_map = std::unordered_map<std::string /*hash*/, patch_container>;
patch_engine();
// Returns the directory in which patch_config.yml is located
static std::string get_patch_config_path();
// Returns the directory in which patches are located
static std::string get_patches_path();
// Returns the filepath for the imported_patch.yml
static std::string get_imported_patch_path();
// Load from file and append to specified patches map
static bool load(patch_map& patches, const std::string& path, bool importing = false, std::stringstream* log_messages = nullptr);
// Read and add a patch node to the patch info
static bool read_patch_node(patch_info& info, YAML::Node node, const YAML::Node& root, std::stringstream* log_messages = nullptr);
// Get the patch type of a patch node
static patch_type get_patch_type(YAML::Node node);
// Add the data of a patch node
static bool add_patch_data(YAML::Node node, patch_info& info, u32 modifier, const YAML::Node& root, std::stringstream* log_messages = nullptr);
// Save to patch_config.yml
static void save_config(const patch_map& patches_map, bool enable_legacy_patches);
// Save a patch file
static bool save_patches(const patch_map& patches, const std::string& path, std::stringstream* log_messages = nullptr);
// Create or append patches to a file
static bool import_patches(const patch_map& patches, const std::string& path, size_t& count, size_t& total, std::stringstream* log_messages = nullptr);
// Remove a patch from a file
static bool remove_patch(const patch_info& info);
// Load patch_config.yml
static patch_map load_config(bool& enable_legacy_patches);
// Load from file and append to member patches map
void append_global_patches();
// Load from title relevant files and append to member patches map
void append_title_patches(const std::string& title_id);
// Apply patch (returns the number of entries applied)
std::size_t apply(const std::string& name, u8* dst) const;
std::size_t apply(const std::string& name, u8* dst);
// Apply patch with a check that the address exists in SPU local storage
std::size_t apply_with_ls_check(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
private:
// Load from file and append to member patches map
void append(const std::string& path);
// Internal: Apply patch (returns the number of entries applied)
template <bool check_local_storage>
std::size_t apply_patch(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
// Database
patch_map m_map;
// Only one patch per patch group can be applied
std::set<std::string> m_applied_groups;
};
+19 -20
View File
@@ -1,7 +1,6 @@
#pragma once
#include "types.h"
#include "asm.h"
#include <climits>
#include <string>
#include <vector>
@@ -59,7 +58,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
const auto write_octal = [&](u64 value, u64 min_num)
{
out.resize(out.size() + std::max<u64>(min_num, 66 / 3 - (utils::cntlz64(value | 1, true) + 2) / 3), '0');
out.resize(out.size() + std::max<u64>(min_num, 66 / 3 - (std::countl_zero<u64>(value | 1) + 2) / 3), '0');
// Write in reversed order
for (auto i = out.rbegin(); value; i++, value /= 8)
@@ -70,7 +69,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
const auto write_hex = [&](u64 value, bool upper, u64 min_num)
{
out.resize(out.size() + std::max<u64>(min_num, 64 / 4 - utils::cntlz64(value | 1, true) / 4), '0');
out.resize(out.size() + std::max<u64>(min_num, 64 / 4 - std::countl_zero<u64>(value | 1) / 4), '0');
// Write in reversed order
for (auto i = out.rbegin(); value; i++, value /= 16)
@@ -136,7 +135,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case '8':
case '9':
{
if (UNLIKELY(ctx.width))
if (ctx.width) [[unlikely]]
{
drop_sequence();
}
@@ -150,7 +149,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case '*':
{
if (UNLIKELY(ctx.width || !src.test(ctx.args)))
if (ctx.width || !src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
}
@@ -166,7 +165,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case '.':
{
if (UNLIKELY(ctx.dot || ctx.prec))
if (ctx.dot || ctx.prec) [[unlikely]]
{
drop_sequence();
}
@@ -177,7 +176,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
}
else if (*fmt == '*')
{
if (UNLIKELY(!src.test(ctx.args)))
if (!src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
}
@@ -200,7 +199,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'h':
{
if (UNLIKELY(ctx.type))
if (ctx.type) [[unlikely]]
{
drop_sequence();
}
@@ -219,7 +218,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'l':
{
if (UNLIKELY(ctx.type))
if (ctx.type) [[unlikely]]
{
drop_sequence();
}
@@ -238,7 +237,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'z':
{
if (UNLIKELY(ctx.type))
if (ctx.type) [[unlikely]]
{
drop_sequence();
}
@@ -252,7 +251,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'j':
{
if (UNLIKELY(ctx.type))
if (ctx.type) [[unlikely]]
{
drop_sequence();
}
@@ -266,7 +265,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 't':
{
if (UNLIKELY(ctx.type))
if (ctx.type) [[unlikely]]
{
drop_sequence();
}
@@ -280,7 +279,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'c':
{
if (UNLIKELY(ctx.type || !src.test(ctx.args)))
if (ctx.type || !src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -302,7 +301,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 's':
{
if (UNLIKELY(ctx.type || !src.test(ctx.args)))
if (ctx.type || !src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -333,7 +332,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'd':
case 'i':
{
if (UNLIKELY(!src.test(ctx.args)))
if (!src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -395,7 +394,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'o':
{
if (UNLIKELY(!src.test(ctx.args)))
if (!src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -452,7 +451,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'x':
case 'X':
{
if (UNLIKELY(!src.test(ctx.args)))
if (!src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -516,7 +515,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'u':
{
if (UNLIKELY(!src.test(ctx.args)))
if (!src.test(ctx.args)) [[unlikely]]
{
drop_sequence();
break;
@@ -563,7 +562,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'p':
{
if (UNLIKELY(!src.test(ctx.args) || ctx.type))
if (!src.test(ctx.args) || ctx.type) [[unlikely]]
{
drop_sequence();
break;
@@ -597,7 +596,7 @@ std::size_t cfmt_append(Dst& out, const Char* fmt, Src&& src)
case 'g':
case 'G':
{
if (UNLIKELY(!src.test(ctx.args) || ctx.type))
if (!src.test(ctx.args) || ctx.type) [[unlikely]]
{
drop_sequence();
break;
+32
View File
@@ -0,0 +1,32 @@
#include "stdafx.h"
#include "cheat_info.h"
#include "Config.h"
#include "StrUtil.h"
LOG_CHANNEL(log_cheat, "Cheat");
bool cheat_info::from_str(const std::string& cheat_line)
{
auto cheat_vec = fmt::split(cheat_line, {"@@@"}, false);
s64 val64 = 0;
if (cheat_vec.size() != 5 || !cfg::try_to_int64(&val64, cheat_vec[2], 0, cheat_type_max - 1))
{
log_cheat.fatal("Failed to parse cheat line");
return false;
}
game = cheat_vec[0];
description = cheat_vec[1];
type = cheat_type{::narrow<u8>(val64)};
offset = std::stoul(cheat_vec[3]);
red_script = cheat_vec[4];
return true;
}
std::string cheat_info::to_str() const
{
std::string cheat_str = game + "@@@" + description + "@@@" + std::to_string(static_cast<u8>(type)) + "@@@" + std::to_string(offset) + "@@@" + red_script + "@@@";
return cheat_str;
}
+30
View File
@@ -0,0 +1,30 @@
#pragma once
#include "stdafx.h"
enum class cheat_type : u8
{
unsigned_8_cheat,
unsigned_16_cheat,
unsigned_32_cheat,
unsigned_64_cheat,
signed_8_cheat,
signed_16_cheat,
signed_32_cheat,
signed_64_cheat,
max
};
constexpr u8 cheat_type_max = static_cast<u8>(cheat_type::max);
struct cheat_info
{
std::string game;
std::string description;
cheat_type type = cheat_type::max;
u32 offset{};
std::string red_script;
bool from_str(const std::string& cheat_line);
std::string to_str() const;
};
+3 -3
View File
@@ -1,4 +1,4 @@
#include "cond.h"
#include "cond.h"
#include "sync.h"
#include "lockless.h"
@@ -38,7 +38,7 @@ void cond_variable::imp_wake(u32 _count) noexcept
}
// Add signal
value += c_signal_mask & -c_signal_mask;
value += c_signal_mask & (0 - c_signal_mask);
return true;
});
@@ -47,7 +47,7 @@ void cond_variable::imp_wake(u32 _count) noexcept
return;
}
if (_count > 1 || ((_old + (c_signal_mask & -c_signal_mask)) & c_signal_mask) == c_signal_mask)
if (_count > 1 || ((_old + (c_signal_mask & (0 - c_signal_mask))) & c_signal_mask) == c_signal_mask)
{
// Resort to notify_all if signal count reached max
m_value.notify_all();
-1
View File
@@ -3,7 +3,6 @@
#include "types.h"
#include "util/atomic.hpp"
#include <shared_mutex>
#include "asm.h"
// Lightweight condition variable
class cond_variable
+2
View File
@@ -1,3 +1,5 @@
#pragma once
#include <string>
namespace utils
+87 -46
View File
@@ -15,10 +15,6 @@ struct size2_base
{
}
constexpr size2_base(const size2_base& rhs) : width{ rhs.width }, height{ rhs.height }
{
}
constexpr size2_base operator -(const size2_base& rhs) const
{
return{ width - rhs.width, height - rhs.height };
@@ -101,18 +97,21 @@ struct size2_base
return *this;
}
constexpr bool operator == (const size2_base& rhs) const
constexpr bool operator ==(const size2_base& rhs) const
{
return width == rhs.width && height == rhs.height;
}
constexpr bool operator != (const size2_base& rhs) const
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator !=(const size2_base& rhs) const
{
return width != rhs.width || height != rhs.height;
}
#endif
template<typename NT>
constexpr operator size2_base<NT>() const
explicit constexpr operator size2_base<NT>() const
{
return{ static_cast<NT>(width), static_cast<NT>(height) };
}
@@ -212,6 +211,8 @@ struct position1_base
return x == rhs;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
bool operator !=(const position1_base& rhs) const
{
return !(*this == rhs);
@@ -221,9 +222,10 @@ struct position1_base
{
return !(*this == rhs);
}
#endif
template<typename NT>
operator position1_base<NT>() const
explicit operator position1_base<NT>() const
{
return{ static_cast<NT>(x) };
}
@@ -247,10 +249,6 @@ struct position2_base
{
}
constexpr position2_base(const position2_base& rhs) : x{ rhs.x }, y{ rhs.y }
{
}
constexpr bool operator >(const position2_base& rhs) const
{
return x > rhs.x && y > rhs.y;
@@ -385,6 +383,8 @@ struct position2_base
return x == rhs && y == rhs;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator !=(const position2_base& rhs) const
{
return !(*this == rhs);
@@ -394,9 +394,10 @@ struct position2_base
{
return !(*this == rhs);
}
#endif
template<typename NT>
constexpr operator position2_base<NT>() const
explicit constexpr operator position2_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y) };
}
@@ -477,6 +478,8 @@ struct position3_base
return x == rhs && y == rhs && z == rhs;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
bool operator !=(const position3_base& rhs) const
{
return !(*this == rhs);
@@ -486,9 +489,10 @@ struct position3_base
{
return !(*this == rhs);
}
#endif
template<typename NT>
operator position3_base<NT>() const
explicit operator position3_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(z) };
}
@@ -567,6 +571,8 @@ struct position4_base
return x == rhs && y == rhs && z == rhs && w == rhs;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator !=(const position4_base& rhs) const
{
return !(*this == rhs);
@@ -576,9 +582,10 @@ struct position4_base
{
return !(*this == rhs);
}
#endif
template<typename NT>
constexpr operator position4_base<NT>() const
explicit constexpr operator position4_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(z), static_cast<NT>(w) };
}
@@ -603,23 +610,11 @@ struct coord_base
};
constexpr coord_base() : position{}, size{}
#ifdef _MSC_VER
//compiler error
, x{}, y{}, width{}, height{}
#endif
{
}
constexpr coord_base(const position_base<T>& position, const size2_base<T>& size)
: position{ position }, size{ size }
#ifdef _MSC_VER
, x{ position.x }, y{ position.y }, width{ size.width }, height{ size.height }
#endif
{
}
constexpr coord_base(const coord_base<T>& other)
: position{ other.position }, size{ other.size }
{
}
@@ -644,13 +639,16 @@ struct coord_base
return position == rhs.position && size == rhs.size;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const coord_base& rhs) const
{
return position != rhs.position || size != rhs.size;
}
#endif
template<typename NT>
constexpr operator coord_base<NT>() const
explicit constexpr operator coord_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(width), static_cast<NT>(height) };
}
@@ -720,10 +718,13 @@ struct area_base
return x1 == rhs.x1 && x2 == rhs.x2 && y1 == rhs.y1 && y2 == rhs.y2;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const area_base& rhs) const
{
return !(*this == rhs);
}
#endif
constexpr area_base operator - (const size2_base<T>& size) const
{
@@ -759,7 +760,7 @@ struct area_base
}
template<typename NT>
constexpr operator area_base<NT>() const
explicit constexpr operator area_base<NT>() const
{
return{ static_cast<NT>(x1), static_cast<NT>(y1), static_cast<NT>(x2), static_cast<NT>(y2) };
}
@@ -769,15 +770,6 @@ template<typename T>
struct size3_base
{
T width, height, depth;
/*
size3_base() : width{}, height{}, depth{}
{
}
size3_base(T width, T height, T depth) : width{ width }, height{ height }, depth{ depth }
{
}
*/
};
template<typename T>
@@ -822,7 +814,7 @@ struct coord3_base
}
template<typename NT>
constexpr operator coord3_base<NT>() const
explicit constexpr operator coord3_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(z), static_cast<NT>(width), static_cast<NT>(height), static_cast<NT>(depth) };
}
@@ -856,7 +848,7 @@ struct color4_base
{
}
constexpr color4_base(T x, T y = {}, T z = {}, T w = {})
constexpr color4_base(T x, T y, T z, T w)
: x(x)
, y(y)
, z(z)
@@ -864,18 +856,59 @@ struct color4_base
{
}
constexpr color4_base(T value)
: x(value)
, y(value)
, z(value)
, w(value)
{
}
constexpr bool operator == (const color4_base& rhs) const
{
return r == rhs.r && g == rhs.g && b == rhs.b && a == rhs.a;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const color4_base& rhs) const
{
return !(*this == rhs);
}
#endif
void operator *= (const color4_base<T>& rhs)
{
r *= rhs.r;
g *= rhs.g;
b *= rhs.b;
a *= rhs.a;
}
void operator *= (const T& rhs)
{
r *= rhs;
g *= rhs;
b *= rhs;
a *= rhs;
}
constexpr color4_base<T> operator * (const color4_base<T>& rhs) const
{
return { r * rhs.r, g * rhs.g, b * rhs.b, a * rhs.a };
}
constexpr color4_base<T> operator * (const T& rhs) const
{
return { r * rhs, g * rhs, b * rhs, a * rhs };
}
constexpr color4_base<T> operator + (const color4_base<T>& rhs) const
{
return { r + rhs.r, g + rhs.g, b + rhs.b, a + rhs.a };
}
template<typename NT>
constexpr operator color4_base<NT>() const
explicit constexpr operator color4_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(z), static_cast<NT>(w) };
}
@@ -911,14 +944,16 @@ struct color3_base
{
return r == rhs.r && g == rhs.g && b == rhs.b;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const color3_base& rhs) const
{
return !(*this == rhs);
}
#endif
template<typename NT>
constexpr operator color3_base<NT>() const
explicit constexpr operator color3_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y), static_cast<NT>(z) };
}
@@ -954,13 +989,16 @@ struct color2_base
return r == rhs.r && g == rhs.g;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const color2_base& rhs) const
{
return !(*this == rhs);
}
#endif
template<typename NT>
constexpr operator color2_base<NT>() const
explicit constexpr operator color2_base<NT>() const
{
return{ static_cast<NT>(x), static_cast<NT>(y) };
}
@@ -985,13 +1023,16 @@ struct color1_base
return r == rhs.r;
}
#if __cpp_impl_three_way_comparison >= 201711
#else
constexpr bool operator != (const color1_base& rhs) const
{
return !(*this == rhs);
}
#endif
template<typename NT>
constexpr operator color1_base<NT>() const
explicit constexpr operator color1_base<NT>() const
{
return{ static_cast<NT>(x) };
}

Some files were not shown because too many files have changed in this diff Show More