Compare commits

..

501 Commits

Author SHA1 Message Date
Ani a86a3d2fee rpcs3_version: Bump to 0.0.12 (#8815) 2020-08-31 23:38:51 +01:00
kd-11 a917f55ef8 vk/sdk: Sync with vulkan SDK v148 (#8814)
- Sync with vulkan SDK 148
- glslang library was split into several smaller libraries
- HLSL is no longer needed
2020-09-01 00:57:38 +03:00
Ani 21b535b5c5 gui/themes: Convert kot-bg to jpg (95%) (#8809)
No perceived loss of image quality, reduces size from 8.1 MB to 2.0 MB
2020-08-31 05:35:42 +01:00
kd-11 af9e217fa4 vk: Improve D16F handling
- Adds upload and download routines. Mostly untested, which is why the error message exists
2020-08-30 09:26:37 +03:00
Bevan Weiss 9a51f22265 Remove call to start m_mousehide_timer in gs_frame constructor 2020-08-29 16:14:11 +02:00
Bevan Weiss 144b185802 Woops... premature commit/push.
Fixed up the usage of connect
2020-08-29 16:14:11 +02:00
Bevan Weiss 3c0f6a2919 Used new Qt connect syntax
Fixed indenting
Renamed click callback argument from 'val'->'checked'
Converted m_gui re-usage to just reference ui
Removed implicit capture from spinbox lambda
Corrected millisecond acronym from mS->ms
Removed superfluous QTimer include in gs_frame.cpp
2020-08-29 16:14:11 +02:00
Bevan Weiss 22c33d4fb4 Added settings and logic for auto-hide of mouse cursor.
In line with the Show Cursor in Fullscreen settings, these settings are only updated when the render window is first launched, and not during the game.
This could be revised (along with the Fullscreen Cursor) if it's more desired.
2020-08-29 16:14:11 +02:00
kd-11 e9cdb248a0 glsl: Properly implement shadow filtering when running emulated shadow compare
- Previous code was completely borked
2020-08-29 02:03:09 +01:00
kd-11 e8274d5a59 vk: Fix depth format mismatch detection in copy_image 2020-08-29 02:03:09 +01:00
Eladash 6952be5ce4 Debugger: Replace SPU register perefix '$' with 'r' 2020-08-28 20:44:13 +02:00
RipleyTom 4317291827 tcp_timeout_monitor deadlock fix (#8783) 2020-08-28 01:06:01 +01:00
Nekotekina bd40430d2b Fix some warnng in lv2.cpp 2020-08-28 01:54:39 +03:00
Nekotekina ebc4a0188a Restore some code 2020-08-28 01:54:39 +03:00
Nekotekina bfa4fcf584 Use g_fxo for progress_dialog_server 2020-08-28 01:54:39 +03:00
Eladash 48f70fbf10 Fix UB in Emulator::Load 2020-08-27 23:52:37 +01:00
Eladash 019d2d5dcf Implement HLE cellSpursAddUrgentCommand 2020-08-27 23:52:37 +01:00
Eladash 17f7f329a8 Log PRX segment end for usage with kernel explorer 2020-08-27 23:52:37 +01:00
Eladash 933737e8f0 PPU: log LR in HLE functions 2020-08-27 23:52:37 +01:00
Eladash 47b545282e SPU: Fix events ACK, minor optimizations (#8771) 2020-08-27 21:36:54 +01:00
RipleyTom 190822c2b2 RPCN Client (#8663) 2020-08-27 20:47:04 +01:00
kd-11 d000d648b0 vk: Fix some minor spec violation
- Stencil clear pass does not consume an image, do not bind one.
- Add push_barrier to allow push-pop semantics for texture barrier insert.
2020-08-27 12:52:28 +03:00
kd-11 d257ba5156 vk: Add some more diagnostic messages for unoptimized image transfer setups 2020-08-27 12:52:28 +03:00
kd-11 9828d6146b rsx: Fix format matching when aggregating textures
- When copying depth-depth, prefer own format over depth int format
2020-08-27 12:52:28 +03:00
kd-11 9e4bec8cec vk: Fix some missing render target declarations 2020-08-27 12:52:28 +03:00
kd-11 65ead08880 rsx: Refactor and improve image memory manipulation routines 2020-08-27 12:52:28 +03:00
kd-11 f6c6c04648 vk: Implement transport for D24S8_FLOAT data 2020-08-27 12:52:28 +03:00
kd-11 794378d5e9 rsx: Do not create depth textures as blit engine targets. 2020-08-27 12:52:28 +03:00
kd-11 a5ac5a9861 rsx: Separate uint depth formats from float depth formats 2020-08-27 12:52:28 +03:00
kd-11 faaf28b41d rsx: Basic support for creating depth float formats 2020-08-27 12:52:28 +03:00
GooseWing 700c540434 Add Nekotekina skin (#8776)
* adding kots

* More sharper neko on background

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-08-27 07:15:24 +02:00
RipleyTom c177bf7480 Forces MSVC Toolkit to 14.25.28610 in Azure Pipelines 2020-08-27 06:39:46 +02:00
Eladash bccfb1cda7 Fix empty input in Registers Editor 2020-08-26 08:20:16 +02:00
Eladash c099bb817f Debugger: Disable PPU address redirection
It causes more confusion than it helps.
2020-08-25 17:43:07 +02:00
Eladash 7fe98d8d66 Debugger: Add missing PPU stack register checks 2020-08-25 17:43:07 +02:00
Eladash d356e0d1e7 Debugger: Register Editor Improvements 2020-08-25 17:43:07 +02:00
Eladash 3ce7fd7894 Debugger: Fix instructions editor 2020-08-25 17:43:07 +02:00
Eladash 6f42297b58 Debugger: Fix scrolling using PageUp, PageDown, KeyUp, KeyDown 2020-08-25 17:43:07 +02:00
Eladash c5aebe4564 Debugger: Implement PPU SLWI, SRWI, SLDI mnemonics 2020-08-24 02:10:51 +03:00
Eladash 841b8fad38 SPU: Fix timer events 2020-08-24 01:57:32 +03:00
Bevan Weiss ab0df0a0f5 Support for Namco GCon3 gun (#8757)
This gun now works (passes calibration) in Time Crisis 4.
2020-08-22 15:41:08 +02:00
Eladash 27e3317449 [HOTFIX] Fix UB in Emu/System.cpp 2020-08-22 11:55:08 +02:00
Eladash edc09e22b4 PSF: Avoid redundent string copies in psf::array/string/get_string (#8707) 2020-08-21 23:55:17 +01:00
Megamouse b487c09d34 Revert "Qt: speed up list refresh"
This reverts commit 715f4f0669.
2020-08-21 09:51:36 +02:00
Eladash 4a40ef6a19 Debugger: Use Signed Hexadecimal formatting (#8751) 2020-08-20 22:07:31 +01:00
Eladash bcddbc15f0 Debugger: Fix PPU stepping on non-TSX 2020-08-19 19:48:35 +01:00
Eladash 2a19d0a579 kernel-explorer: Add RSX handlers events info 2020-08-19 09:09:24 +02:00
Megamouse 9af66e22da evdev: log axis information in pad settings 2020-08-18 18:29:35 +02:00
Megamouse 715f4f0669 Qt: speed up list refresh 2020-08-18 11:00:04 +02:00
Megamouse e6e753f37f Qt/Linux: fix QT_AUTO_SCREEN_SCALE_FACTOR typo 2020-08-18 10:04:31 +02:00
Megamouse e958c3cc6a Qt: fix YoRHa QTreeWidget item style for CheckBoxes 2020-08-18 10:04:31 +02:00
Eladash 19500ac9ad Fix truncation warning in sys_cond.cpp 2020-08-17 17:36:27 +01:00
Eladash 25dee4a78e Fix bitops test 2020-08-17 17:36:27 +01:00
Eladash ee953f7953 Fix vm::reservation_update 2020-08-16 22:58:49 +03:00
Zion Nimchuk acee590733 Ensure pushing builds to Github is only done on master branch 2020-08-16 17:35:19 +01:00
Zion Nimchuk cd94d9849d Windows GitHub release hotfix
Improve id variable parsing and print release.json to catch error
2020-08-16 17:35:19 +01:00
Zion c3709fa744 Manually upload Windows Github Release using curl. Actually fixes #7938 (#8715)
For some reason Azure would evaluate the GitHub release instantly and
complain about missing/invalid GitHub Release deployment and fail to
even start the build, this fixes the issue by just manually uploading it
via the GitHub API and curl.
2020-08-15 20:46:53 +01:00
Eladash 853e2b90a3 rsx: Minor rsx::ceil_log2 bugfix 2020-08-15 20:39:21 +03:00
Eladash 995cb8125e SPU LLVM: Improve approx FCGT (#8728) 2020-08-14 19:33:35 +01:00
Bevan Weiss 01d3585bf3 Bring back the non-compliant define, but version limited
As noted, we've done something we shouldn't have with MSVC compiler specific defines.  But to avoid breaking the MSVC build environment, leave this define in there until the MSVC version when it is actually exposed by the compiler itself (v16.8).
2020-08-14 18:34:34 +01:00
Bevan Weiss a11afe05bf MSVC changes
Add support for compilation on x64 toolchain (x86 cl.exe was running out of heap space in vm.cpp)

Also took the opportunity to change compile optimisation from /Ox to /O2, as /O2 provides better optimisation than does /Ox

Also, we shouldn't be explicitely setting compiler tool defines (__cpp_lib_bitops), so remove that from types.h
2020-08-14 18:34:34 +01:00
Whatcookie 9e4f43f4d1 SPU LLVM: Add icelake optimized paths for SHUFB (#8712) 2020-08-13 15:00:56 +01:00
Eladash 8cdfe5952a SPU/PPU LLVM: Improve 0 addend FMA detection (#8709) 2020-08-13 04:13:08 +03:00
Eladash 0f8ca1f7c5 SPU: Implement RSX accurate reservations on TSX (#8721) 2020-08-13 00:00:37 +01:00
kd-11 fd2607ad52 rsx: Fix XBGR vs XRGB screenshots 2020-08-12 20:19:19 +03:00
kd-11 7e1b24224d rsx: Support XBGR flip image load from Cell memory 2020-08-12 20:19:19 +03:00
kd-11 56c63170b9 vk: Warn if GPU does not support RGBA8 natively 2020-08-12 20:19:19 +03:00
kd-11 b41349546c rsx: Proper support for typeless transform of ABGR framebuffers using the RGBA8 format 2020-08-12 20:19:19 +03:00
kd-11 6850533b50 rsx: Unify composite texture creation and management
- Some texture accesses require image compositing steps to assemble the requested image from existing subresources.
  Handle all the common routines in a unified manner to avoid having one broken path (e.g mipmap gather not supporting bitcast operations)
2020-08-10 13:31:22 +03:00
Whatcookie 4ce2ad54a8 PPU LLVM: Use VPERM2B to emulate VPERM (#8704)
- The VPERM2B instructions are a match of VPERM's behavior, besides operating in reverse byte order
2020-08-09 01:50:26 +01:00
Eladash 0c85d4c0d0 cellSaveData: Fix loss of "BLIST" and files' information in PARAM.SFO (#8706) 2020-08-08 23:40:47 +01:00
Eladash 57471f8c94 SPU LLVM: Fix signed zeroes handling on Accurate xfloat 2020-08-08 22:21:22 +01:00
Eladash 7e11855330 SPU/PPU LLVM: Fix FMA signed zeroes handling 2020-08-08 22:21:22 +01:00
Malcolm Jestadt f188589685 Utils: Add detection for Icelake-client tier AVX-512
- Implies support for everything that Skylake-X supports as well as AVX512IFMA, AVX512VBMI, AVX512VBMI2, AVX512VPOPCNTDQ, AVX512BITALG, AVX512VNNI, AVX512VPCLMULQDQ, AVX512GFNI, AVX512VAES
2020-08-08 00:33:22 +02:00
Megamouse 96428a7555 Log username 2020-08-07 21:57:08 +02:00
illusion d3585e1f80 move accurate rsx reservation to advanced 2020-08-07 09:34:27 +02:00
illusion c0c86521a2 add missing settings to configure 2020-08-07 09:34:27 +02:00
kd-11 22f5e7a9be vk: Generate valid image+image_view combinations for placeholder texture descriptors 2020-08-06 20:34:49 +03:00
Megamouse 06c42bba5d Qt: fixup for PKG installation 2020-08-06 17:32:29 +02:00
Bevan Weiss ada6db2df4 Replace ppu_module_manager Function Static with Class Static variable (static module map) (#8669)
* Replace ppu_module_manager Function Static with Class Static

Makes for a slightly 'cleaner' interface in my opinion, may also assist with adding thread read/write concurrency support in future if ever required (have left that out of this commit to match existing function).

Very slight performance improvements were seen in representative testing.
https://quick-bench.com/q/GMbgeNc-mZc21aqOKCofnbzPZvg

I didn't investigate whether static initialisation of the static_modules might actually be possible here, perhaps there's a way to do a constexpr / consteval of this.

* Fix up for old style cast syntax..

* Fixups from PR comments

Plus remove spurious type_traits include (from me) not picked up in previous PR

* Remove old code

* Update rpcs3/Emu/Cell/PPUModule.h

Co-authored-by: Eladash <elad3356p@gmail.com>

* Fix naming of static variable

Co-authored-by: Eladash <elad3356p@gmail.com>
2020-08-06 12:34:08 +02:00
Bevan Weiss eee5e812f7 Fix for incorrect assignment of ghlguitar
found_ghltar was potentially being overwritten if multiple USB devices were present
2020-08-06 12:01:21 +02:00
Bevan Weiss eb5ae94c24 sys_usbd tidy ups
Tidy up fake transfer iterator handling. erase invalidates all iterators including the current iterator (i.e. 'it'), given precedence ordering this was UB prior to C++17.  Splitting out to use return iterator from erase seems cleaner.
Also added some additional info to usb debug message to potentially help with #8666, and used the atomic (dev_counter) less often
2020-08-06 12:01:21 +02:00
kd-11 7109fe9889 rsx: Improve swizzled layout detection
- Reset swizzle flag to false automatically on section reset.
- Detect render target payload and extract swizzle information from it.
2020-08-05 23:23:38 +03:00
Megamouse 17557df9f4 Qt: unify package installation logic 2020-08-05 08:10:22 +02:00
Megamouse fab1f7d939 Qt: add rap files to pkg install file dialog 2020-08-05 08:10:22 +02:00
Megamouse 815d6f4223 Qt: fix input lag in pad settings
Looks like repainting stuff inside a resizeable layout is slow AF
2020-08-04 16:15:13 +02:00
Megamouse 25d73f5a70 Try to fix ugly GUIs 2020-08-03 22:03:15 +02:00
Megamouse d633a266c1 Add config override as cli arg: --config <path>
And add some more logging
2020-08-03 21:31:53 +02:00
dio-gh 938bf8624c make some cfg logs error instead of fatal
- in case there's a default value to fall back to, log with error
  instead of with a fatal
2020-08-03 20:59:47 +02:00
Megamouse 2cdb46b167 Qt: do not use on_<obj>_<action> syntax for slots
Qt tries to auto connect those
2020-08-03 20:17:35 +02:00
Megamouse 8799eebfe1 Qt: move some more settings to persistent_settings 2020-08-03 20:17:35 +02:00
Eladash 70fb5712e5 PPU interpreters: Fix VMAXFP NaN and signed zeroes handling 2020-08-03 15:43:00 +01:00
Eladash 6a51c27fde PPU LLVM: Fix VMAXFP, VMINFP NaN handling 2020-08-03 15:43:00 +01:00
Eladash 17f965c171 lv2: Minor fix of "unspecific ppu" path of _sys_lwcond_signal 2020-08-03 02:57:20 +03:00
kd-11 bd21930d1a rsx: Decode swizzled GPU data on CPU readback
- Currently this conversion is being done on the CPU to reuse as much code as possible.
  The expectation is that this almost never happens, so there is not point in increasing maintenance burden by adding compute paths
2020-08-02 16:14:11 +03:00
kd-11 4df933275b rsx: Propagate raster type of fbo sourced data throughout the pipeline.
- Tracks which kind of raster was done (Z-ordered vs linear) throughout the application.
- This allows to identify if data is in the expected format or not.
2020-08-02 16:14:11 +03:00
Megamouse 107129f95a Fix missing GPU in game window title 2020-07-31 01:13:00 +02:00
JohnHolmesII e11734f971 CI: Avoid trying to publish builds on forks 2020-07-30 23:36:10 +02:00
Megamouse 3bba9708d9 Gracefully abort headless mode with unsupported video renderers
Also fix no_return bug
2020-07-30 20:03:51 +02:00
Eladash dd497625a5 PPU LLVM: Fix constant folding of BitCast 2020-07-30 17:06:24 +01:00
Eladash f6764767f6 SPU/PPU LLVM: Fix cpu_translator::get_const_vector<v128>() 2020-07-30 17:06:24 +01:00
Eladash e52dd9dc6f SPU: Implement SYS_SPU_THREAD_OPTION_DEC_SYNC_TB_ENABLE (#8657) 2020-07-30 14:01:25 +01:00
Megamouse 03ae1481fb Don't open an error dialog in headless mode 2020-07-30 12:17:35 +02:00
Eladash 82068cf802 SPU: Fix spu_thread::cpu_stop() missed executions (#8656) 2020-07-30 10:07:18 +01:00
Megamouse ebf832214e cheat_manager: notify if no game is running 2020-07-29 13:18:33 +02:00
Megamouse 4315363f4b cheat_manager: make sure that the patches path exists 2020-07-29 13:18:33 +02:00
Megamouse f073ff8fe8 overlays: fix minor warning 2020-07-29 13:18:33 +02:00
Megamouse 47040be3ad cheat_manager: improve parser errors 2020-07-29 13:18:33 +02:00
Megamouse d0bb9d2b62 cheat_manager: move cheats.yml to patches folder 2020-07-29 13:18:33 +02:00
Megamouse cb6e536fbd cheat_manager: use enum values for columns 2020-07-29 13:18:33 +02:00
Megamouse f820a7a205 cheat_manager: disable search buttons if nothing was entered in the search field 2020-07-29 13:18:33 +02:00
Megamouse 16212854b4 cheat_manager: fix long search result lists 2020-07-29 13:18:33 +02:00
Megamouse 1c6003acd5 Improve error handling of config nodes
These conditions are most likely only gonna be met during development
2020-07-29 11:28:16 +02:00
Megamouse ef3e8d26ce Improve error handling during config loading 2020-07-29 11:28:16 +02:00
Eladash 21a1072117 SPU LLVM: Minor cleanup after #8559 2020-07-29 03:32:21 +03:00
MSuih 2ce49e3674 Improve error messages in firmware install 2020-07-28 20:55:33 +02:00
Megamouse e58e1ebfd9 Qt: fix download menu visibility 2020-07-28 20:07:21 +02:00
Bevan Weiss 609182b131 Update cellAudio to use float constants instead of doubles
Another simple Clang recommendation
2020-07-26 17:23:02 +03:00
Bevan Weiss 7898ae6fe6 VK_REMAP enum is signed.. but later case comparison is unsigned
another clang directed fix up... might be involved with swizzle..
2020-07-26 15:27:51 +03:00
Malcolm Jestadt a9d0ffcac1 SPU LLVM: Avoid additional endian swapping
- Avoid additional endian swapping with the ROTQBY and ROTQBYBI instructions
- ROTQBYI is left out intentionally, since it caused worse codegen
2020-07-26 11:36:50 +01:00
Malcolm Jestadt 824be77bba SPU LLVM: Avoid redundant endian swapping
- PSHUFB operates in reverse byte order from SHUFB, so we can take advantage of that to swap endianness without additional transformations in some situations
2020-07-26 11:36:50 +01:00
Ani 74c8a44d84 rsx: Fix cache skipping shaders on load+compile (#8633)
When on single worker mode (OpenGL or an hypothetical scenario of a 
single core PC with Vulkan), load and compile would skip 10% of the 
shaders on queue each stage.

Co-authored-by: kd-11 <karokidii@gmail.com>
2020-07-26 08:47:50 +01:00
Whatcookie 9f829b375a SPU/PPU LLVM: Optimize VSEL/SELB with constant mask (#8559) 2020-07-25 17:59:35 +01:00
Eladash da44d5f10d PPU: Fix DIVW, DIVWU, MULHW, MULLW, MULHWU when op.rc is set (#8630) 2020-07-25 17:13:58 +01:00
kd-11 be4b71b805 vk: Fixup for PR #8590
- This change was lost during rebase
2020-07-25 14:48:11 +03:00
kd-11 b0c7ca6d1f vk: Improve video memory manager to attempt recovery in out of memory situations 2020-07-25 14:48:11 +03:00
kd-11 4d8de282f9 vk: Improve typeless texture succession
- Ensure incoming texture is large enough that the original one fits inside it to avoid back-and-forth succession.
- Make use of the resource manager to remove the obsolete textures to avoid holding on to the them which "leaks" VRAM.
  The memory isn't leaking, it's just wasting space in temporary pool until renderer is closed.
2020-07-25 14:48:11 +03:00
Bevan Weiss c5d39ace2b Update types.h to fix static_cast test (#8627)
Trivial fix up to resolve invalid is_constructible test (To,To) to match desired (To,From)
2020-07-25 09:46:47 +01:00
Megamouse de80a4b6c7 overlays: try to fix unexpected font crop 2020-07-25 10:21:52 +03:00
Eladash 917069e31a PPU Precise/LLVM: Support NJ modes (#8617) 2020-07-25 07:41:41 +01:00
Eladash 3354c800d7 SPU/PPU LLVM: Improve expressions matching (#8620) 2020-07-24 16:53:48 +01:00
Megamouse bb3ac62126 cellMic: use s32 consistently 2020-07-24 14:47:10 +02:00
Megamouse 6e25fea16a use not_an_error in sys_spinlock_trylock 2020-07-24 14:47:10 +02:00
Megamouse 5e7c6853c2 fix truncation warnings 2020-07-24 14:47:10 +02:00
Megamouse f76a011ba0 fix sceNpCommerce2CreateCtx log message 2020-07-24 14:47:10 +02:00
Megamouse d854a39500 add a gazillion more error_code 2020-07-24 14:47:10 +02:00
Megamouse a00ebacef3 cellFont: add error_code 2020-07-24 14:47:10 +02:00
Megamouse c2f4244c4d cellMic: error_code, random cleanup and stubbing 2020-07-24 14:47:10 +02:00
Megamouse 7437c324c6 cellMusic: add error_code 2020-07-24 14:47:10 +02:00
Eladash 54b87b6dbb cellSaveData: Increase sleep time 2020-07-23 13:45:58 +03:00
Eladash a029a94c73 SPU: Use waitable atomics for SPU channels interface 2020-07-23 13:45:58 +03:00
illusion 3157a10428 move executable hash log level to success 2020-07-22 10:51:19 +02:00
Eladash f8d2d8ca11 SPU/Windows: Fix LS memory mirrors
This is a workaround but this is because of how utils::shm works on Windows path.
2020-07-19 17:58:49 +03:00
Eladash 0d8152cd4e SPU/Linux: Ensure aligned 64k allocations in utils::memory_reserve 2020-07-19 17:58:49 +03:00
Eladash c37bc3c55c SPU: Make spu_thread::offset private 2020-07-19 17:58:49 +03:00
Malcolm Jestadt 6cc0fe4221 SPU LLVM: Avoid negative clamping when the input is known to be positive 2020-07-19 17:56:59 +03:00
Eladash af1ceb1151 SPU LLVM: LS Memory Mirrors (Optimize loads/stores) 2020-07-18 02:01:33 +03:00
Eladash c1a80b8146 Minor fixup after #8501 2020-07-16 21:52:08 +03:00
Eladash 268bcd1c7b rsx: Fix false desync events 2020-07-16 19:26:10 +02:00
kd-11 42a9ac9e6c rsx: Brute-force removal of superseded surfaces 2020-07-16 19:11:26 +03:00
kd-11 182b20c33d rsx: Fix draw count append when draw ranges are out of order
- It is common for draw counts to truncate at 256 even when it makes no sense to do so.
- e.g 256 is not a multiple of 3 so triangles will glitch out
2020-07-14 16:04:44 +03:00
Eladash 58e2465369 Make std::bit_cast hack-implementation constexpr in simple cases 2020-07-14 12:14:44 +03:00
Eladash 07a44d0ff9 Implement constexpr byteswapping 2020-07-14 12:14:44 +03:00
Jan Beich d00f882c23 Qt/input: unbreak with Qt 5.15 after 881e8e4723
rpcs3/rpcs3qt/pad_settings_dialog.cpp:674:16: error: variable has incomplete type 'QPainterPath'
                QPainterPath path;
                             ^
/usr/local/include/qt5/QtGui/qmatrix.h:54:7: note: forward declaration of 'QPainterPath'
class QPainterPath;
      ^
2020-07-14 08:33:56 +02:00
Megamouse e70e534bfa Qt: Fix YoRHa background for some widgets 2020-07-14 02:08:15 +02:00
Megamouse d345916241 Qt: Fix Skyline's QSpinBox and QDoubleSpinBox buttons 2020-07-14 02:08:15 +02:00
Megamouse fe8bcac270 Qt/input: add tooltips to pad settings 2020-07-14 00:06:43 +02:00
illusion 60f05fdbf3 move applied patch log level to success 2020-07-13 22:33:03 +02:00
Megamouse ad0f12c742 Qt/input: add checkbox for emulated stick values 2020-07-13 21:23:48 +02:00
Megamouse 2f2a03b37b Qt/input: fix stick preview for disconnected pads 2020-07-13 21:23:48 +02:00
Megamouse 881e8e4723 Qt/input: show emulated sticks in pad settings 2020-07-13 21:23:48 +02:00
Megamouse e1af6dc4af Qt/input: add squircle to pad settings dialog 2020-07-13 21:23:48 +02:00
Megamouse 4d9533ea54 input: use left and right squircle values 2020-07-13 21:23:48 +02:00
Eladash d6623e0f22 RSX debugger: fix command count on non-method commands (#8578)
* RSX debugger: fix command count on non-method commands

* fixup

* constants and variables
2020-07-12 12:40:47 +02:00
kd-11 ab3d36f0f3 rsx: Fix depth bounds test
- Allow depth bounds test to access the Z buffer even when depth test is disabled.
2020-07-10 15:59:15 +03:00
kd-11 632af8d723 rsx: Support partial texture descriptors
- It is safe to declare w > pitch and it works as long as sampling inside the legal 2D area is obeyed.
2020-07-10 15:26:07 +03:00
Eladash 282b00674a SPU LLVM: Optimize non-constant Tag Update requests 2020-07-10 02:52:02 +03:00
Eladash 235d12aa6b SPU MFC: Never clear tag status in WrTagUpdate 2020-07-10 02:52:02 +03:00
Eladash 5d1fc546a8 SPU MFC: Fix MFC_WrTagUpdate channel count
Always report available, in realhw this is just a hint if the previous tag update hasnt been checked yet by the MFC, avoiding blocking writes and allowing the SPU to execute some code while it processes the previous update request.
Except for MFC_TAG_UPDATE_IMMEDIATE, where it also waits for MFC to process it.
2020-07-10 02:52:02 +03:00
Eladash eb993781ef RawSPU: Log MMIO access 2020-07-09 23:24:47 +03:00
Megamouse 0756fd9c7e Qt: fix pad settings resize when switching tabs 2020-07-09 08:20:37 +02:00
Megamouse a3e79fc105 Qt: fix scrollArea focus during pad button choice
Assigning arrow keys was broken because of this
2020-07-09 08:20:37 +02:00
Eladash 84470c34db SPU: Disable PUTLLC NOP transfers detection on TSX path 2020-07-09 03:17:35 +01:00
Eladash f8dbfa1d1e SPU: Implement GETLLAR polling detection 2020-07-09 03:17:35 +01:00
Eladash d9750e8f9f SPU/PPU reservations: Optimizations for reservation locks and check_state() (non-TSX) 2020-07-09 03:17:35 +01:00
Megamouse e09c4b72c8 Qt: fix update menu for linux 2020-07-08 22:21:27 +02:00
Megamouse 53b95fea19 audio: rename audio channels to audio downmix
The setting does not actually define the channels themselves, only the downmix option that the PS3 provides.
Channels might be changed seperately in the future.
2020-07-08 21:11:23 +02:00
Megamouse e2fd4e46f7 Only reboot audio if a relevant setting changed 2020-07-08 21:11:23 +02:00
Megamouse 20d6664dc1 Try to make most audio configs dynamic 2020-07-08 21:11:23 +02:00
Megamouse 8ee953ef8e XAudio2: Call CoInitializeEx to prevent errors
I could not properly reset the audio backend and call CreateMasteringVoice without getting errors
2020-07-08 21:11:23 +02:00
Megamouse 5b7ee43352 XAudio2: print readable errors 2020-07-08 21:11:23 +02:00
Megamouse 8add57f8e9 VS: show linux audio backends in solution explorer 2020-07-08 21:11:23 +02:00
Megamouse bb0aaea92d cellAudio: implement downmix to 5.1 2020-07-08 21:11:23 +02:00
kd-11 987ede2e6c vk: Inject memory barrier upon conclusion of a framebuffer feedback loop
- Do not write to the texture until previous draw call is completed using it.
- This is usually not much of a problem until blending operations come into play.
2020-07-08 19:23:29 +03:00
Megamouse 5fae1b3637 HLE: fix sceNpDrmGetTimelimit invalid param error 2020-07-07 09:43:32 +02:00
Derrik Touve cb08c53f2f sys_net: Use np_handler dns if possible for sys_net_infoctl (#8557)
Without this, cellHttpSendRequest will use the hardcoded dns 192.168.1.1, which won't work if you're not on that network.
2020-07-07 08:25:29 +02:00
Megamouse 171e4fafed Emu: simplify Emu::Stop some more 2020-07-06 21:14:16 +02:00
Megamouse 8d2ce2815c Emu: Make prevent_display_sleep dynamic 2020-07-06 21:14:16 +02:00
Megamouse d91551c277 Emu: always use Emu.Quit() to quit RPCS3
This creates a single possible point of failure for calling quit()
2020-07-06 21:14:16 +02:00
Megamouse 332f9cae77 Qt: Remove obsolete main window close()
The gui settings aren't part of the main window anymore
2020-07-06 21:14:16 +02:00
Eladash dc25a3fa2a PPU debugger: Show stack address of each function 2020-07-06 18:58:16 +02:00
Eladash c98ec4d014 PPU debugger: Fix functions stack bounds check 2020-07-06 18:58:16 +02:00
kd-11 05dc6ad610 gl: Silence warnings 2020-07-05 16:58:44 +03:00
kd-11 3fe8499956 rsx: Improve ZCULL queued requests finalization
- Unifies the code
- Allows conditionals to be evaluated with a forwarder present
2020-07-05 16:58:44 +03:00
Megamouse f1b1c9053c Input/Qt: Check if gui callbacks are nullptr 2020-07-04 14:28:19 +02:00
Megamouse ea4cc0b395 Qt: use button box for most buttons 2020-07-04 14:28:19 +02:00
Megamouse be8980fc23 Qt: add scrollarea to pad settings dialog 2020-07-04 14:28:19 +02:00
Megamouse e4a9c177e6 Qt: Random unimportant stuff 2020-07-04 14:28:19 +02:00
Megamouse 99be645fcc Qt: Add stick multipliers to the pad dialog 2020-07-04 14:28:19 +02:00
Megamouse f8920edb2e patch_manager: save "owned games only" state 2020-07-03 18:09:06 +02:00
kd-11 acf51f0ead rsx: Fix transfer descriptors for partially overlapping slices in head
- Height must be corrected to skip the piece that exists before the current slice
2020-07-03 14:29:54 +03:00
Megamouse ddd202b5ff Qt: fix signal_update_available
m_update_message has to be non empty
2020-07-03 00:21:58 +02:00
Megamouse 78eb7e73bc Qt: remove automatic param from update logic
At that point we already had user interaction, so there is no point in hiding the error dialogs
2020-07-03 00:21:58 +02:00
Eladash 72337f2678 SPU LLVM: Fix barrier commands enqueuing 2020-07-02 22:46:02 +03:00
Megamouse 14200c1a1f Qt: refactor curl stuff into a downloader
And add 'Background' updater
2020-07-02 20:22:58 +02:00
Megamouse c495ef10b0 Qt: fix random QWinTaskbarProgress crashes 2020-07-02 20:22:58 +02:00
Megamouse 3bdce6050b Qt: random cleanups 2020-07-02 20:22:58 +02:00
kd-11 c9c0d7361d rsx: Implement fast ZCULL barrier when query object is already known 2020-07-02 20:11:57 +03:00
kd-11 d7ffc8b4ac rsx: Fix leaking ZCULL queries after a barrier
- Multiple queries can be queued up, process them all before completing the barrier
2020-07-02 20:11:57 +03:00
Megamouse b5f01372ee Windows: distinguish left and right modifiers
This is just some workaround until we either use a different input api for keyboards or until we refactor the keyboard_pad_handler to use Qt with native scan codes
2020-07-02 12:55:27 +02:00
Megamouse bec6bde919 Qt/Input: update keyboard_pad_handler shortcuts
This is just some patchwork before the shortcuts get refactored eventually
2020-07-02 12:55:27 +02:00
Megamouse 1f25924384 Qt/Input: remove unused function: GetModifierCode 2020-07-02 12:55:27 +02:00
Jacques Yakoub 36cf5dca82 localized.h: follow Sony Naming Conventions (#8539)
* localized.h: follow Sony Naming Conventions

See this : https://github.com/RPCS3/rpcs3/issues/4259 (Main Window -> (Localized) Replace the category names with either something more gramatically correct or something used in Sony Naming Conventions)
2020-07-02 09:39:10 +02:00
Bird Egop eea12bad07 Implement Caret upwards and downwards move in overlay_edit_text (#8342)
* Implement caret upwards and downwards move in overlay_edit_text

* Optimize caret up and down movement

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-07-02 09:06:37 +02:00
Ani 6a9fe8e3c4 rpcs3_version: Bump to 0.0.11 2020-06-30 22:35:17 +01:00
Megamouse 55e907385b patch_manager: warning for incompatible patches (#8535)
* patch_manager: warning for incompatible patches

This will open a warning dialog whenever the patch manager is opened and incompatible patches are detected.

* Apply suggestions from code review

Co-authored-by: Bird Egop <sampletext32@bk.ru>

Co-authored-by: Bird Egop <sampletext32@bk.ru>
2020-06-30 21:35:15 +02:00
kd-11 bd14429f20 vk: Disable primitive restart for old GCN cards
- Also adds more Navi 14 chips to detection table
2020-06-30 15:00:07 +03:00
Megamouse 5867b3b72e patch_manager: fix items across refreshs 2020-06-30 03:04:35 +02:00
Megamouse 45e1a8756f patch_manager: fix import dialog close button 2020-06-30 03:04:35 +02:00
Megamouse 6742fad753 patch_manager: fix import, use constants as keys
And improve import logging again
2020-06-30 00:45:17 +02:00
Megamouse c6190fa95d patch_manager: improve import logging
imported_patch.yml has to be the latest version too
2020-06-29 23:56:27 +02:00
Megamouse 372eff2d8f patch_manager: fix sorting of item counters >= 10
This only deals with less than 100 items (that amount is undesirable in the first place)
2020-06-29 23:56:27 +02:00
Megamouse 98eb0cd3f2 patch_manager: fix legacy patches again 2020-06-29 23:56:27 +02:00
Megamouse 541e20cbec patch_manager: allow Notes as sequence 2020-06-29 23:56:27 +02:00
Megamouse ef203f6bcb patch_manager: fix owned games o. for all versions 2020-06-29 23:56:27 +02:00
Megamouse a5368d766a patch_manager: prefer specific > global (per hash) 2020-06-29 23:56:27 +02:00
Megamouse cf2e2a0511 patch_manager: one patch per group across hashes 2020-06-29 23:56:27 +02:00
Megamouse e5bb5f02e0 patch_manager: Always move All titles to the top 2020-06-29 23:56:27 +02:00
Megamouse 3a17eefde7 patch_manager: restrict All serials to All titles 2020-06-29 23:56:27 +02:00
Megamouse 7d2ecbf29a patch_manager: don't hide "All Serials" in 'owned' 2020-06-29 23:56:27 +02:00
Megamouse c72a6f8e6f patch_manager: prefer serial patches over All 2020-06-29 23:56:27 +02:00
Megamouse 6a486d3402 patch_manager: only apply one patch per group
So far this was purely handled in the GUI
2020-06-29 23:56:27 +02:00
Megamouse e43db24b2c patch_manager: add All override
All can now be used as a key for title, serial and/or app version.
If you check a patch for all ... then the patch will be applied regardless of what's checked for the game specifically, because we do not save 'Unchecked' patches.
2020-06-29 23:56:27 +02:00
Megamouse 3ea33763bc patch_manager: add expand and collapse
Also reorder the context menu and remove some options if not applicable
2020-06-29 23:56:27 +02:00
Megamouse 695cfead16 patch_manager: add option to only show owned games
and remove the app version level from the gui
2020-06-29 23:56:27 +02:00
Megamouse 12dded403f patch_manager: implement serials and app_versions 2020-06-29 23:56:27 +02:00
Eladash a7a5034958 remove redundent include in Crypto/unedat.cpp (#8527) 2020-06-29 18:03:38 +01:00
Megamouse fa81146b79 Use proper install paths depending on pkg content 2020-06-29 10:36:24 +02:00
Megamouse 5269b69bc5 cellAudio: use downmix formula based on documentation 2020-06-29 09:06:36 +02:00
Eladash d9e3f0ccfa types.h: Fix ASSUME macro side-effects mismatch between compilers 2020-06-29 03:10:05 +01:00
Eladash 2483cc6f8d Fix race in Crypto/unedat.cpp, Make NPDRM keys usage atomic 2020-06-28 23:26:10 +01:00
Eladash 97717defa5 Remove devKlic/rifKey reset 2020-06-28 23:26:10 +01:00
kd-11 5e29bdbe22 vk: Add more GPUs to nvidia chip table
- Registers more TU116 and TU117 variants
- Registers GA100
2020-06-28 22:54:58 +03:00
kd-11 b437794e92 vk: Improve nvidia speedhack for non-turing cards
- Inverts the chip family check to skip any unidentified GPUs altogether
2020-06-28 22:54:58 +03:00
Eladash 9fcbad326a debugger: Fix registers editor 2020-06-28 11:51:24 +02:00
Eladash 2c93fecd8b SPU: Use named constants for MFC tag updates 2020-06-27 20:42:41 +01:00
Eladash 20fcc6530f SPU LLVM: Fix WRCH instruction to WrTagUpd 2020-06-27 20:42:41 +01:00
illusion 11e75853a6 ui: add rsx some options to gui (#8512)
disable hw fp16 to advanced
3d tv support to gpu
2020-06-27 19:19:35 +01:00
Eladash 9cb4402c16 Make error_code::value member private 2020-06-27 09:02:55 +01:00
Eladash f29589e5cf SPU debugger: Add atomic status and tag update channels information 2020-06-27 07:04:37 +01:00
Eladash d7842b7de2 SPU LLVM: Fix WRCH instruction to WrTagMask 2020-06-27 07:04:37 +01:00
Megamouse 5a8eb9d3d7 Input: skip keyboard input when pads are disabled 2020-06-26 09:28:58 +02:00
Megamouse ab4c40c988 pad_thread facepalm 2020-06-26 09:28:58 +02:00
kd-11 5ea6535fd5 rsx: Force flushing of NaN/INF to zero
- This option was always enabled for NVIDIA cards, but it seems some games would benefit from the option on other GPUs as well.
- TODO: Hwtest to verify correct behavior and plan how to safely implement in hw
2020-06-26 09:24:15 +03:00
Megamouse 76faaf43f7 Input: Use global variables for pad modifications 2020-06-26 04:42:52 +02:00
Megamouse 9679ae68cb patch_manager: more information for branch nodes 2020-06-25 22:14:18 +02:00
Megamouse 7d3389d548 patch_manager: save widget layout 2020-06-25 20:49:57 +02:00
Eladash ab9cdc70ad cellSaveData: Emulate PPU processing of auto/list post-fixed callback 2020-06-25 19:50:33 +03:00
Eladash e45d37073a debugger: Shortend SPU/PPU thread names 2020-06-24 17:44:06 +02:00
JohnHolmesII e353ad3557 Update BUILDING.md
Change Qt version to reflect the fact that nothing older or newer than 5.14.2 will build. Sad times.
2020-06-24 16:10:26 +02:00
Megamouse abec850379 patch_manager: add hash to applied log message 2020-06-24 15:31:55 +02:00
Megamouse 431e0eb30c patch_manager: fix missing config path 2020-06-24 15:31:55 +02:00
kd-11 628cb1c779 rsx: Validate blend factors according to hardware testing 2020-06-23 12:15:02 +03:00
kd-11 a14e0a0104 rsx: Validate stencil op to match realhw behavior 2020-06-23 12:15:02 +03:00
kd-11 f3637cdfdb rsx: Fix surface options hint mechanism
- Silly typo
2020-06-23 12:15:02 +03:00
kd-11 c6a9a5d5d7 rsx/fixup: Fix color clear logic
- Enable fast clears on ABGR formats in vulkan
- Fix disabling color clears for unsupported formats in GL
2020-06-23 12:15:02 +03:00
Megamouse 7e3ece7d9f Update readme badges 2020-06-23 03:34:36 +02:00
kd-11 7f917c8ba5 rsx: Fix ABGR decoding for colormask and clear color
- The bytes in these values are based on the format according to hw tests
- G8B8 is unaffected as the first two bytes are already G8B8 for A8R8G8B8 standard layout (BGRA)
- A8B8G8R8 and its derivatives have words 0 and 2 exchanged.
2020-06-22 20:12:41 +03:00
kd-11 e992cbe01b rsx: Support DRGB8 sampling of render targets 2020-06-22 20:12:41 +03:00
Megamouse 1974911a71 patch manager: Skip legacy patch.yml in the GUI
The legacy patches aren't supposed to be shown in the GUI anyway.
2020-06-21 15:48:30 +02:00
Megamouse 8659994b2c patch manager: Fix load order 2020-06-21 15:48:30 +02:00
Megamouse 5affc459a2 patch manager: Allow partial patch file import 2020-06-21 15:48:30 +02:00
Megamouse cd4ed11700 patch manager: Add patch removal to context menu
Also avoid saving empty patch maps
2020-06-21 15:48:30 +02:00
Megamouse c4fe418f66 patch manager: fix tree refresh and item expansion 2020-06-21 15:48:30 +02:00
Megamouse 7d9d58f38f patch manager: Properly hide legacy patches 2020-06-21 15:48:30 +02:00
Megamouse b212f29cf2 patch manager: "Show Patch File" in context menu 2020-06-21 15:48:30 +02:00
Megamouse fd2cd84555 patch manager: Skip lower patch_versions 2020-06-21 15:48:30 +02:00
Megamouse bf978ac8ca patch manager: properly check patch versions
Also abort patch import of lower patch versions
2020-06-21 15:48:30 +02:00
Megamouse d3c6472c0f patch manager: replace Version and Title keys
With Patch Version and Game Title
2020-06-21 15:48:30 +02:00
Megamouse 1c7a318413 patch manager: move try catch block to yaml.cpp 2020-06-21 15:48:30 +02:00
Megamouse 591624b96c patch manager: avoid patch import inconsistencies
Save the original patch value instead of the interpreted value
2020-06-21 15:48:30 +02:00
Megamouse 2323cd2a2d patch manager: move title + serials to patch level
Also bump patch file version to 1.1
2020-06-21 15:48:30 +02:00
Megamouse cc5c89539b patch manager: improve error handling
There shouldn't be much left that can crash this thing
2020-06-21 15:48:30 +02:00
Megamouse a7ee059419 patch manager: import patches 2020-06-21 15:48:30 +02:00
xperia64 7d5c8fe553 Change DLL permissions so Windows clients which respect permissions set them correctly (#8470) 2020-06-20 21:44:38 +01:00
Megamouse fd048a75da Qt: Improve update manager messages
- Add restart hint to success message
- Use days to measure time greater than 24 hours
2020-06-20 17:12:45 +02:00
Oschowa 5c1ce6350b FAudio: remove 4x volume factor
Same as commit 66d13da2ac for the XAudio2 backend
2020-06-20 12:42:56 +02:00
Eladash d86c9a2549 sys_mmapper: rewrite page fault thread notifications
* Fix a corner case where SPU thread has the same ID as a PPU thread.
* Fix a potential deadlock on Emu.Stop() while sending event in EBUSY loop.
* Thread specific notifications.
2020-06-18 20:13:54 +03:00
sampletext32 249686708c Update Github Issue Template: Regression 2020-06-18 06:49:59 +03:00
Eladash 3ee1d8aed1 fixup 2020-06-18 06:47:07 +03:00
Eladash 5c6dae498b SPU LLVM: Avoid bad optimization in FCGT 2020-06-18 06:47:07 +03:00
kd-11 2086e7f2e8 rsx: Account for subpixel precision when converting DST coordinates to
SRC coordinates

- When extracting a 1x1 texture from another texture of a different
  format, width conversion can result in a dimension of 0 if the
extracted texel is not a full texel in SRC
2020-06-17 22:18:47 +03:00
sampletext32 4092e3e95f Update Github Issue Template: Bug 2020-06-17 15:46:33 +03:00
kd-11 c764925b4d rsx: Properly handle conversion of G8B8 and related formats
- These formats are 16-bit packed, not separate 8-bit channels. Conversion requires byteswap for them.
2020-06-16 22:36:38 +03:00
kd-11 83d818d96f rsx: Improve mipmap gathering
- Account for source offsets when grabbing subregions
- Scale input accordingly when sourcing from fbo in all paths
2020-06-16 19:12:03 +03:00
RipleyTom 3d3c91d654 std header guard in BEType.h (#8448) 2020-06-16 01:06:15 +01:00
sampletext32 0ad4e91001 Avoid string reallocation in swizzle CgBinaryProgram 2020-06-15 22:26:49 +03:00
Eladash 731d4330fe v128: A few optimizations (#8432) 2020-06-15 17:24:04 +03:00
Eladash 5777a1d426 SPU: Implement EBUSY error on non-empty mailbox (sys_spu_thread_send_event/sys_event_flag_set_bit)
Write into inbound mailbox under mutex.
2020-06-15 17:08:57 +03:00
Eladash 5fda9a4efb sus_lwcond_signal_all: use protocol specified in lwmutex
Trying to fix a nearly impossible corner case.
2020-06-15 17:08:57 +03:00
Eladash c15b5f1eca SPU: Move check_state() outside of mutex scope
Can result in a deadlock in some cases, cpu flags are checked after this function as well anyways.
2020-06-15 17:08:57 +03:00
Eladash 314dc4c5de sys_cond: Fix spurious EBUSY in sys_cond_destroy
Increment waiters count inside IDM's mutex lock scope.
2020-06-15 17:08:57 +03:00
Eladash a0f0f58fc5 sys_event_queue: Fix IPC support 2020-06-15 17:08:57 +03:00
Eladash 92b7c56f29 sys_cond/mutex: Fix race between sys_cond_create and sys_mutex, Fix IPC support in sys_cond/mutex 2020-06-15 17:08:57 +03:00
kd-11 8d8fb4a2e4 rsx: Remove ARGB->D24S8 conversion shader which has been deprecated for years since compute capabilities were added to the emulator 2020-06-15 14:18:12 +03:00
sampletext32 717e851a99 Create Github Issue Template: Feature Request 2020-06-15 00:46:48 +03:00
kd-11 2e737ad483 rsx: Fix surface option invalidation
- Depth buffers can be in special "read" state when writes are disabled. Account for this.
2020-06-14 23:30:03 +03:00
Eladash 88a0e0fe2d cellAudio: Minor fixup 2020-06-14 18:45:46 +01:00
Eladash e2248332ae rsx: Make "Disable ZCull Occlusion" setting dynamic 2020-06-14 18:45:46 +01:00
kd-11 3663a8ab4d rsx: Improve surface options invalidation 2020-06-14 20:13:12 +03:00
Eladash 5430892052 sys_vm: Limit total process vsize to 256MB (#8431) 2020-06-14 15:27:34 +01:00
Eladash ff04cd6d69 cellAudio: Fix event queue attachment 2020-06-14 02:31:23 +03:00
Eladash aa4fdff82c Fix lv2_obj::name64 regression 2020-06-14 02:25:29 +03:00
Eladash 5bc4f9df0d debugger: Always show zeroes on no thread's instructions positions 2020-06-14 02:08:04 +03:00
Eladash 5d0066029f debugger: Fix instructions foreground/background color changes on non-executable memory 2020-06-14 02:08:04 +03:00
Eladash 56962a58da Fix debugger breakpoints 2020-06-14 02:08:04 +03:00
Malcolm Jestadt 746615a937 Fix embedded spu elf patching 2020-06-13 23:18:44 +02:00
Nekotekina e485c9c79c Atomically overwrite config.yml
Protection against data corruption.
2020-06-12 22:41:50 +03:00
Eladash bd6fdf3f2d rsx: Optimize rsx::rsx_iomap_table construction 2020-06-12 22:40:58 +03:00
Eladash e1f8573c68 sys_net: Fix sys_net_bnet_setsockopt page faults 2020-06-12 22:39:13 +03:00
Eladash 4bc157881d sys_net: Stub sys_net_infoctl command 9 2020-06-12 22:39:13 +03:00
Eladash f0d526411c IDM: Implement idm::clear<typename> 2020-06-12 22:12:36 +03:00
kd-11 e1183f6919 gl: Fix depth buffer byteswap hint
- uint24_8 is not actually swapped, it is decoded in a special way
2020-06-12 20:49:47 +03:00
kd-11 f4ec28d932 rsx: Merge instruction expand flag with the other sign expand flags
- Avoids double expansion when both the exp_tex flag is set AND the texture also is sampled as signed
- Should fix missing eyeballs in Mass Effect 1 with the previous sign expansion fix
2020-06-12 20:19:20 +03:00
kd-11 ce587f43a0 rsx: Implement signed normalized texture formats
- Already partially supported via EXP option in the shader opcode, but format decoding was disabled.
- Noticed in some UE3 games which use _SNORM variants on PC but _UNORM on rpcs3
2020-06-12 20:19:20 +03:00
Eladash 6892399699 kernel_explorer: More Improvements 2020-06-12 09:28:23 +02:00
Megamouse 22b1cc765a patch manager: hotfix for legacy patches
Assignment of invalid YAML nodes is not possible after all
2020-06-11 22:23:02 +02:00
Eladash b9cb181691 sys_memory: Improve allocation/deallocation syscalls 2020-06-11 20:03:32 +03:00
Megamouse 4a03f06175 patch manager: add checkbox for "enable legacy" 2020-06-11 16:31:49 +02:00
Ilya 768bb8d31f Workaround broken Azure badge link
Looks like Azure has broken API a bit, so link to the full list of the latest builds in the meantime
2020-06-11 14:08:11 +02:00
Eladash 0bf8f2a527 PPU interpreters: Fix VRFIM, VRFIN, VRFIP, VRFIZ 2020-06-11 14:31:38 +03:00
Megamouse 2dca8d84e1 patch manager 2020-06-11 13:15:25 +02:00
JohnHolmesII 1668900fb8 Update Azure config to fix Windows Azure build (#8399)
Co-authored-by: Eladash <elad3356p@gmail.com>
2020-06-11 04:14:09 +01:00
Megamouse 66f1cbfb34 kernel_explorer: keep existing trees expanded 2020-06-09 16:48:20 +02:00
sampletext32 b75af69cf9 Improve tooltips 2020-06-08 05:51:52 +03:00
Eladash c36c425fb9 kernel explorer: Improvements 2020-06-08 05:46:36 +03:00
sampletext32 f75b26d1c9 Unify Azure artifacts names and produce them only on successful build. 2020-06-08 05:38:39 +03:00
Nekotekina bfee541540 Atomically overwrite games.yml
Reduce chances of losing information.
2020-06-07 22:44:07 +03:00
Nekotekina 3d7c38ff9d Remove lambda in sys_net_bnet_poll 2020-06-07 22:44:07 +03:00
Nekotekina 5d27f1c732 PPU: implement VNMSUBFP (precise variant) 2020-06-07 22:44:07 +03:00
Nekotekina 3b8e7d0967 Implement v128::fma32f 2020-06-07 22:44:07 +03:00
kd-11 ebbf329b6a gl: Improve async compiler synchronization with initialization
- On multithreaded mesa, the program initialization routine was not
  being flushed correctly. Set up synchronization fence after initialization
is complete.
2020-06-07 12:54:34 +03:00
kd-11 87cc937d4e rsx/fp: Separate SRC precision modifiers
- SRC0, SRC1 and SRC2 have different bits for precision modifiers all stored inside SRC1
- This explains the strange observed behavior of the MAD instruction which has 3 inputs
2020-06-07 12:07:27 +03:00
Malcolm Jestadt dcf5c06d6d SPU LLVM: Optimize FM when op.ra == op.rb 2020-06-06 22:27:48 +03:00
Malcolm Jestadt 8357523ec0 SPU LLVM: Additional FCGT optimizations 2020-06-06 22:27:48 +03:00
Malcolm Jestadt 39149fd84d SPU LLVM: Partial revert for FM/FMA changes and other improvements
- Revert changes to FM and FMA instructions
- Allow non accurate/approx FMA family instructions to use native FMA
- Minor optimization for FMA ops with a constant 0 multiply
2020-06-06 22:27:48 +03:00
Malcolm Jestadt 289c594187 SPU LLVM: Fix theoretical issue with FCGT optimizations 2020-06-06 22:27:48 +03:00
kd-11 d47d597b34 vk: Make the depth-convert pass multisample aware 2020-06-05 17:19:24 +03:00
kd-11 69c2150fbd vk: Fix query reset when renderpass is active
- Performs delayed query reset on-demand
2020-06-05 17:19:24 +03:00
Bird Egop 334d0bbc86 Add Cirrus CI FreeBSD badge (#8350) 2020-06-05 01:45:21 +01:00
Megamouse 1cb4fb9c50 stub cellPngEnc 2020-06-04 23:13:40 +03:00
Megamouse 413f87b737 Add error_code to cellPngDec 2020-06-04 23:13:40 +03:00
Megamouse 8a8edb1b62 stub sceNpCommerce2 2020-06-04 23:13:40 +03:00
Megamouse caa1324457 stub sceNpTus 2020-06-04 23:13:40 +03:00
ibrakap 776c2ada6a Remove mentionbot config 2020-06-04 23:10:54 +03:00
Megamouse 41eb6d4461 cellAudio improvements
- use CELL_AUDIO_BLOCK_32 where possible
- use CELL_AUDIO_BLOCK_SAMPLES where possible
- remove redundant logging
- return CELL_AUDIO_ERROR_AUDIOSYSTEM in cellAudioGetPortConfig (probably unreachable code anyway)
- return CELL_AUDIO_ERROR_PORT_OPEN in cellAudioPortOpen
- stub cellAudioSetPersonalDevice cellAudioUnsetPersonalDevice and cellAudioMiscSetAccessoryVolume
2020-06-04 23:09:47 +03:00
illusion 0315781306 Audio dumper: append filename with titleid and date-time
prevents overwrite of old file

Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-06-04 20:10:56 +03:00
sampletext32 437f374bae Fix some checks 2020-06-04 19:48:08 +03:00
Ani 9657b3f1d4 Fix sys_net_bnet_poll regression (#8337)
Co-authored-by: Eladash <elad3356p@gmail.com>
2020-06-04 17:30:11 +01:00
kd-11 650152e05f rsx: Fix fragment state updates
- Fix copypasta for POLYGON_STIPPLE_PATTERN vs SET_POLYGON_STIPPLE method binding
- Use proper enums for ROP_control bits to avoid confusion
2020-06-03 22:05:33 +03:00
kd-11 73fe9b51de rsx/fp: Ignore self-referencing register writes.
- Sometimes, usually with shaders that do pack/unpack operations, there is a write-to-self operation.
  For example r0.xy = r0.xy
  Obviously no new data was introduced into "r0" by this, so we should not mark the register as having new data.

- TODO: Investigate on realhw if self-reference is needed to "cast" the overlapping half registers to their full register counterparts.
2020-06-03 09:45:02 +03:00
kd-11 26b2e4253d rsx: Properly account for memory sizes of reused surfaces 2020-06-02 21:37:57 +03:00
kd-11 b353bf6c56 rsx: Improve surface cache resource management
- Do not allocate too many objects. This is a problem in games using dynamic memory allocators that can make it rare for a surface to fall on the same address twice, keeping zombie RTVs and DSVs alive much longer than needed.
- Current limit used is 256M of virtual VRAM which is impossible on retail PS3
2020-06-01 22:24:27 +03:00
Malcolm Jestadt c601374b1f SPU LLVM: Use clamping helpers for FMA32x4 and FM 2020-06-01 21:39:28 +03:00
Megamouse 66d13da2ac XAudio2: remove nasty 4x volume factor 2020-06-01 19:05:48 +03:00
Nekotekina 938ca90a02 Improve Stop Watchdog
Prevent termination if PPU LLVM compilation is in progress.
2020-06-01 02:27:33 +03:00
Nekotekina 2d2ed7efd0 Add game patch support in 'Create PPU Caches'
Try to compile patched version of EBOOT.BIN
2020-05-31 23:06:54 +03:00
Nekotekina 1507a59786 SPU LLVM: fix spu_cache dependency
Should fix possible crash on exit.
2020-05-31 21:54:04 +03:00
Eladash 675fde69aa Avoid copying std::shared_ptr in sys_semaphore 2020-05-31 21:02:52 +03:00
Megamouse 99895471ae cellAudio: make master volume dynamic 2020-05-31 07:37:59 +02:00
Megamouse 3e2aede85c VS: randomly changed project files 2020-05-31 07:37:59 +02:00
Nekotekina 377ad9887c Compile EBOOT.BIN on 'Create PPU Caches' 2020-05-31 02:26:40 +03:00
kd-11 c9a978a03e Typo fix
Co-authored-by: Megamouse <studienricky89@googlemail.com>
2020-05-30 14:47:10 +03:00
kd-11 59d44cd1cc gl: Fix shader logging 2020-05-30 14:47:10 +03:00
kd-11 542a6aed51 rsx: Add stippled rendering support to interpreters 2020-05-30 14:47:10 +03:00
kd-11 1677618c75 rsx: Implement stippled rendering 2020-05-30 14:47:10 +03:00
Eladash 3df83e03a9 SPU: Fix possible deadlock after access violation via DMA transfers 2020-05-28 23:23:11 +03:00
Eladash a199c71a55 SPU: Fix page faults notifications (non-TSX) 2020-05-28 23:23:11 +03:00
Eladash 3d20ce70f5 rsx: Fix possible case NULL zcull_ctrl in on_exit() 2020-05-28 11:56:02 +02:00
Eladash f0cdd8ace6 PPU: Implement PPU Traps Stubbing option 2020-05-27 22:39:29 +03:00
Nekotekina 8e9d2fa70e SPU LLVM: implement get_segment_base()
Fake function used to compute 32-bit offset of local functions.
2020-05-27 18:53:09 +03:00
Nekotekina abf9a08ee3 Fix warnings 2020-05-27 18:41:17 +03:00
ZeeWanderer 9d02231074 [CI, Cache] Add proper cache versioning (#8285) 2020-05-26 00:33:59 +01:00
xddxd f56b362769 rsx: Copypasta fix (#8289) 2020-05-25 20:07:11 +01:00
Eladash 865180e63e sys_mmapper: Fix possible memory leak on error of create_lv2_shm 2020-05-24 19:24:07 +03:00
Eladash 3265772ae4 idm: Implement creation/destruction invalidation counter
* "Ensures" newely created IDs won't have the same ID as old destroyed objects for lv2_obj. (256 tries cycle)

Similar to how the kernel implements it.
2020-05-24 19:24:07 +03:00
kd-11 224a0e4b1a rsx: Fix data format remapping
- Includes missing 0xEE and 0x44 variants of the 2-component data format remapper
2020-05-24 13:51:19 +03:00
kd-11 bd41a108d8 nv3089: Account for subpixel addressing
- Those strange offsets noted in some games seem to match to subpixel addressing.
  For example, when scaling down by a factor of 4, a pixel offset of 2 will end up inside pixel 0 of the output
2020-05-24 11:31:37 +03:00
ZeeWanderer 695b6e8f46 [MSVC 16.6] Microsoft.MakeFile.Targets(46,5) :thisisfine: (#8279) 2020-05-23 14:53:49 +01:00
Maxim Kulyk ab6942d974 [CI, sh, Windows] Do shallow submodule init. History is not needed. 2020-05-23 11:52:17 +01:00
Maxim Kulyk 6efc735728 [CI, Windows] build SPIRV-Tools separately 2020-05-23 11:52:17 +01:00
Jan Beich 3048bb1a75 Add FreeBSD to CI (#8261)
* CI: add FreeBSD job

* CI: add FreeBSD job on CirrusCI

* CI: disable Travis on FreeBSD due to broken ccache
2020-05-23 00:54:28 +03:00
Eladash b8f86eb78d SPU: Fix page faults notifications 2020-05-23 00:48:28 +03:00
Mrlinkwii 68bee397eb Update cellSpurs.h 2020-05-22 22:19:04 +03:00
Eladash a703f6febb kernel explorer: Add information about first PRX/overlay segment 2020-05-22 17:37:22 +03:00
Eladash 81749f4353 SPU/PPU disasm: replace unknown instructions message with question marks 2020-05-22 17:37:22 +03:00
Eladash 2d1d36678d SPU/PPU disasm: replace "illegal address" with question marks 2020-05-22 17:37:22 +03:00
Eladash 0e6abd66ca PPU disasm: do not disassmble non-executable memory 2020-05-22 17:37:22 +03:00
kd-11 7080305d82 vk: Implement masked stencil buffer clears
- Partial stencil buffer clears were not implemented. This is for example where a game can choose to clear only some bits from the stencil buffer.
- Vulkan does not support masked stencil clears natively, it has to be implemented as a graphics operation.
- Also refactors vulkan overlay passes to use global resource system instead of forcing the render backend to own all of them and manage lifetimes.
2020-05-21 19:27:23 +03:00
Eladash 7c3166a0c6 SPU MFC: Fix MFC_WrListStallAck on interpreters 2020-05-20 22:55:30 +03:00
Eladash 4405f46aec SPU MFC: Fix SN interrupts 2020-05-20 22:55:30 +03:00
Eladash 81684919f5 SPU MFC: Implement MFC_SDCRZ_CMD 2020-05-20 22:55:30 +03:00
sampletext32 1a8fb61373 Fix some misspells
Note: in main.cpp there are many dirs similar to Program Files, so tip should be appropriate.
2020-05-20 22:53:24 +03:00
Malcolm Jestadt c47d04fd2f SPU: Optimize FCGT
- Optimize FCGT to a single signed integer comparison when possible
- Add is_spu_float_zero helper
2020-05-20 21:55:01 +03:00
ZeeWanderer 91ee480e56 [msbuild] only link llvm libs to Applications (#8262)
Previously llvm libs were linked into all lib pjojects that import `rpcs3_llvm.props` which resulted in 200+ MB libs and probably longer compile time.
2020-05-20 07:40:14 +01:00
sampletext32 3d320aea2c Optimize Qt properties in about_dialog
https://doc.qt.io/qt-5/qt.html#TextInteractionFlag-enum
2020-05-19 08:18:21 +02:00
Megamouse 703841e251 Qt: disable TSX in the config.yml if not supported 2020-05-18 17:46:31 +02:00
Megamouse 1fffffad7a Qt: properly handle strict rendering mode switch 2020-05-18 17:46:31 +02:00
Nekotekina 72fedccaba rsx_utils.h: fix signed/unsigned comparison 2020-05-18 00:51:57 +03:00
Nekotekina ae519200ed Implement std::countl_zero and friends
Trying to fix macos build.
2020-05-18 00:51:57 +03:00
Eladash 201d54ee08 PPU interpreters: Implement AltiVec NaNs precedence and data preservation 2020-05-18 00:35:06 +03:00
JohnHolmesII 2591d99db1 Dev: Switch to dropbox for Vulkan SDK for reliability 2020-05-17 22:01:59 +01:00
JohnHolmesII a2327de3cb Dev: Switch to alternate Qt host for reliability 2020-05-17 22:01:59 +01:00
Ani 581176fb1a gl: Restrict insert_vertex_input_fetch workaround to Intel proprietary
It works fine on Mesa iris
Fixes detection of Mesa as recent Mesa does not have "x.org" on vendor string, allowing vendor_MESA to become true instead of vendor_INTEL on Mesa Intel
2020-05-17 17:49:14 +03:00
Eladash 377e2ce3e8 rsx: Write 4-byte long data to all semaphores (#8246)
* rsx: Write 4-byte long data to all semaphores
2020-05-17 17:48:35 +03:00
Eladash a2653532ef SPU reservations (TSX): Remove wait flag in PUTQLLUC 2020-05-17 14:20:21 +03:00
kd-11 37df3c6f96 rsx/fp: Fix precision clamping on MAD instruction 2020-05-17 09:11:26 +03:00
AniLeo a8bca8b2ed gl: Only log shaders if g_cfg.video.log_programs is enabled 2020-05-16 16:16:17 +01:00
AniLeo b0d3c4d75e gl: Refactor shader type usage
Use Common/GLSLTypes.h program_domain instead of duplicated own internal
type
2020-05-16 16:16:17 +01:00
AniLeo 3db2f23e02 gl: Refactor shader compilation 2020-05-16 16:16:17 +01:00
Ani 661636efef gl: Check for EXT_depth_bounds_test
Avoid glEnable/glDisable GL_DEPTH_BOUNDS_TEST_EXT flood that returns 
GL_INVALID_ENUM if the feature isn't supported
2020-05-16 14:50:05 +01:00
AniLeo 99f5145aab glsl: Avoid implicit int->uint conversions
Silences debug output regarding implicit int -> uint conversions
2020-05-16 11:45:59 +01:00
Eladash 8a0425570c rsx: Fix data written to RSX semaphores and the initial data of them (#8235) 2020-05-16 09:55:56 +01:00
AniLeo eecb22e749 gl: Remove older debug code
KHR_DEBUG path makes this obsolete, usage of this older path has been 
removed a long time ago
2020-05-16 08:29:00 +01:00
AniLeo 3ad12cf5f8 gl: Avoid issuing glDelete calls with m_id == GL_NONE
Applies GL_NONE macro usage where it makes sense
2020-05-16 08:29:00 +01:00
AniLeo d4333788e2 glext.h: update from 20180114 to 20200423
Include newly added khrplatform.h as well
2020-05-16 08:29:00 +01:00
AniLeo 308cdfac35 gl: Rewrite Debug Output
Remove Windows restriction, enable Debug Output for every supported OS
Filter our severity by Khronos severity
Handle and log source and type enums
2020-05-16 08:29:00 +01:00
illusion db4414ca87 GUI followup for https://github.com/RPCS3/rpcs3/pull/8148 2020-05-15 20:01:39 +03:00
Zion b5dbb2eb36 Bump Linux CI version (#8226)
This updates Qt to 5.14.2, Ninja to 1.10.0, SDL2 to 2.0.12
2020-05-15 04:04:24 +01:00
Nekotekina 67b002f586 Update Contributors 2020-05-15 01:46:12 +03:00
Nekotekina e186ef9490 Update Developers 2020-05-15 00:53:39 +03:00
Nekotekina cccc5bc18d Update Supporters 2020-05-15 00:50:13 +03:00
Nekotekina 7824419bbf Remove std::rotr usage for now
It seems to be missing on some std implementations.
2020-05-14 21:42:44 +03:00
Mrlinkwii c22d778143 Spelling fix in texture_cache.h (#8219)
heurestic_end -> heuristic_end
2020-05-14 21:42:21 +03:00
Eladash 61f43d78df SPU: Minor cleanup of exception in stop_and_signal 2020-05-14 16:58:50 +01:00
Eladash 54dd9f4eae sys_spu: Fix sys_spu_thread_group_terminate vs sys_spu_thread_group_exit race on values 2020-05-14 16:58:50 +01:00
Eladash 91d06a9729 SPU LLVM: fixup after #8175 (#8214)
Mask out RESULT cmd bit, do not create unbound branch blocks. (non-TSX)
2020-05-14 13:34:14 +01:00
kd-11 310f367fb1 rsx: Improve blit engine memory validation (#8215)
- In blit engine logic there is a tendancy to over-allocate so as to avoid having to sticth together textures later
- Sometimes this can lead to out of bounds access and crash applications, so memory must be validated
2020-05-14 12:57:58 +01:00
Nick Renieris b1fb5b6239 Emu/Config: Add option for accurate PPU LLVM vector NaNs
Turned off by default.
2020-05-14 11:14:28 +01:00
Nick Renieris 20d8d38e53 PPU Interpreter: Accurate vector instruction NaNs
Tested with https://github.com/RPCS3/ps3autotests/tree/master/tests/cpu/ppu_vpu.
This commit gets us from 2746 to 353 different lines compared to realhw.
2020-05-14 11:14:28 +01:00
Nick Renieris 78ac2a86bb PPU LLVM: Accurate vector instruction NaNs
Tested with https://github.com/RPCS3/ps3autotests/tree/master/tests/cpu/ppu_vpu,
results in that test improved by about half.
2020-05-14 11:14:28 +01:00
kd-11 cc723ed45c vk: Properly fix dynamic state descriptors 2020-05-13 22:20:43 +03:00
kd-11 ed82288c1b rsx/fp: Support more types of texture access
- Allows more instructions to correctly decode depth textures
2020-05-13 22:20:43 +03:00
Eladash 7680466e0d Minor EFAULT fix in sys_semaphore_get_value/sys_event_flag_get
ESRCH preceeds EFAULT in both syscalls.
2020-05-13 19:36:44 +03:00
Eladash 9266507e4c SPU: Implement spu_channel_(4_)t::try_read 2020-05-13 19:36:44 +03:00
Eladash 8cca113ef4 sys_spu: Add short sleep in sys_spu_thread_group_terminate 2020-05-13 19:36:44 +03:00
Eladash 7ff25588f4 sys_spu: Minor cleanup of group termination process 2020-05-13 19:36:44 +03:00
Eladash 93122196d9 vm: Fix vm::passive_lock regression (#8175)
possible broken signaling in rare occusions.
2020-05-13 16:53:59 +03:00
Eladash 5c4c8f4539 PPU: Use optimized reservation waiting for reservation load (non-TSX) 2020-05-13 16:53:59 +03:00
kd-11 118bfbbe98 rsx: Rewrite data texture remap expansion
- 16-bit channel formats have special 0x4|0xE encoding for only 2 channels, not 4
- float textures do not take any remapping and crash if you try it.
  Depth float textures work fine though.
2020-05-13 14:33:22 +03:00
Eladash 12f0278808 SPU LLVM: Improve MFC transfers recompilation for non-TSX 2020-05-13 11:10:13 +01:00
Eladash b38580bf32 SPU: Use optimized PPU signaling to SPU on reservation pause 2020-05-13 11:10:13 +01:00
Eladash 525453794f SPU/PPU reservations: Optimizations part 1
- Implement vm::reservation_trylock, optimized locking on reservation stores with no waiting. Always fail if reservation lock bitsa are set.
- Make SPU accurate GET transfers on non-TSX not modify reservation lock bits.
- Add some optimization regarding to unmodified data reservations writes.
2020-05-13 11:10:13 +01:00
Megamouse eb5ec211c2 Input: remember registered ldd controllers
- Don't reset ldd pads when saving a pad config
- Prevent configuration of registered ldd pads in the gui while ingame
2020-05-13 11:17:58 +02:00
JohnHolmesII 69ea573b0d vk: Remove more deprecated VK_DYNAMIC_STATE_RANGE_SIZE usage (#8206) 2020-05-13 02:52:01 +01:00
kd-11 dd9397473a vk: Remove deprecated enum VK_DYNAMIC_STATE_RANGE_SIZE (#8202) 2020-05-12 22:36:55 +01:00
sampletext32 86cf8a1717 Fix possible cur_ip nullptr usage in np_handler.cpp 2020-05-12 18:28:12 +02:00
Megamouse 6374a9f19b Qt: remove debug tab wall for Utilities menu
In order to make it easier for the user to take RSX captures.
2020-05-12 16:48:56 +02:00
Eladash f95b81574f sys_spu: Fix race in sys_spu_thread_group_destroy and other minor fixes (#8182)
* sys_spu: Fix race in sys_spu_thread_group_destroy and other minor fixes

* SPU: Wait for all threads to have error codes if exited by sys_spu_thread_exit

On last thread in group to run.

* sys_spu: Fix sys_spu_thread_group_start

* fixup ad fix sys_spu_thread_group_terminate

idk why "- !group->running" was put in the first place but its probably no longer relevant due to other changes and was causing other issues such as not always waiting for last SPU thread to set group state to INITIALIZED.
2020-05-11 21:24:04 +03:00
Maxim Kulyk d67e77899f [CI] xenial 1.2->1.3 2020-05-11 16:40:28 +03:00
RipleyTom dd5c54290c Improves skylander generation (#8177) 2020-05-11 11:57:13 +01:00
kd-11 b6e8560532 rsx/fp: Fix PK2/UP2 instruction
- These variants take unsigned scalar inputs, not signed.
- Fixes ARGB8->X16Y16 in SR: Gat out of Hell
2020-05-11 09:37:00 +01:00
Maxim Kulyk 5dc8b05275 [CI] Update VulkanSDK to 1.2.135.0 2020-05-10 21:13:04 +01:00
Maxim Kulyk 48ecc00368 [msbuild] Exctract Cmake cmd line to variable
Same change as was made for llvm_build
2020-05-10 21:13:04 +01:00
Maxim Kulyk 04ead3cba4 [msbuild] Change vulkan libs dir search priority
VulkanSDK 1.2.135.0+ comes with a lot more libs including glslang.lib and SPIRV*.lib. This allows to load all rpcs built libs first.
2020-05-10 21:13:04 +01:00
kd-11 79e2a87bc5 rsx: Fix NOP shader passing
- NOP shaders are used to stub rendering when a pass is supposed to be disabled
2020-05-10 21:54:34 +03:00
Eladash bd61347b21 sys_spu: reset group exit status in sys_spu_thread_group_start 2020-05-10 03:46:11 +01:00
Eladash 09797c3584 sys_spu: Improve sys_spu_thread_get_exit_status 2020-05-10 03:46:11 +01:00
kd-11 14969cd8d0 rsx: Disable SCA writes to output register if vec result flag is set.
- Noticed when debugging X-men origins: wolverine which has a bogus SCA op whilst writing vector to output
- It makes no sense for both SCA and VEC to both write to the same register in the same instruction as memory ordering becomes an issue
2020-05-08 14:35:07 +03:00
kd-11 79c54aeba9 rsx: Move analyser dump to its own config option 2020-05-08 14:35:07 +03:00
kd-11 a1b6415c5a rsx: Fix alpha ref
- The alpha ref register is compared directly to the ROP output register in realhw
- alpha ref content must match bit-width of ROP register, which means fp16 values are possible
2020-05-08 00:02:47 +03:00
Megamouse 8e2b2bc179 Don't load custom configs when adding games 2020-05-07 18:10:49 +02:00
Nekotekina e1042bc631 Get rid of "module" keyword
Workaround some intellisense problems.
2020-05-06 18:20:11 +03:00
Eladash a6025df7de vm: reset stack memory after deallocation 2020-05-06 18:03:37 +03:00
Megamouse 5c4b8e8dee Input: fix xinput deadzones 2020-05-06 09:33:38 +02:00
Megamouse f95bf01c78 Input: fix trigger scaling
this is not a problem at the moment, but if you increase the trigger_max then the old code reports values bigger than 255
2020-05-06 09:33:38 +02:00
Megamouse d4606cfdb9 Input: remame some functions 2020-05-06 09:33:38 +02:00
Nekotekina 907adc817e Fix some warnings (GCC) 2020-05-05 21:55:22 +03:00
Nekotekina a6f0b1b532 Fix get_thread_affinity_mask (Linux/BSD)
Uninitialized variable (facepalm).
2020-05-05 21:44:32 +03:00
Eladash 1bd6cb2105 SPU/PPU debugger: use ':' instead of '=' 2020-05-05 13:46:26 +03:00
kd-11 142a1da0e0 Fix windows build 2020-05-05 13:18:03 +03:00
kd-11 fb3d5827f0 Fix linux build 2020-05-05 13:18:03 +03:00
kd-11 a3f25bc7c7 rsx/interpreter: Fix DIVSQ instruction 2020-05-05 13:18:03 +03:00
kd-11 a0f63a31e3 vk: Enable optimization passes for generated SPIRV 2020-05-05 13:18:03 +03:00
kd-11 f72385b00c vulkan: Import spirv-tools subproject and update glslang 2020-05-05 13:18:03 +03:00
kd-11 4f7c020e63 glsl: Improve VGPR usage
- VGPR usage lowered from 159 -> 127 for texturing. Occupancy doubled from 1 to 2
- Eliminate most temporary registers
2020-05-05 13:18:03 +03:00
Pavel 9a4c26dc8c Qt: Option to disable keyboard hotkeys 2020-05-04 01:10:44 +03:00
Eladash edde748519 sys_event_queue: Fix forced event queue destruction
Add missing last existence check at sys_spu_thread_(try)receive_event and lv2_event_queue::send.
2020-05-04 01:10:19 +03:00
Eladash 37ce7056ac lv2: Minor optimization for "awake all" threads in sleep queue 2020-05-04 01:10:19 +03:00
Eladash b84b8f4db4 sys_cond_signal_all: Use SYS_SYNC_PRIORITY protocol to signal threads 2020-05-04 01:10:19 +03:00
Eladash 72bef8dd7f PPU: Clear reservation on context switch
Ensure that only 2 PPU reservations exist at maximum at a time.
2020-05-02 14:57:38 +03:00
Eladash 0e6937a359 SPU GETLLAR: Don't use loop detection for TSX 2020-05-02 14:57:38 +03:00
MSuih b18dcd7660 Add fs::error for when disk is full 2020-05-02 14:54:41 +03:00
Megamouse 2b69a68ef6 Qt: show mouse in fullscreen 2020-05-02 09:27:54 +02:00
Nekotekina fc68c508c8 LLVM DSL: fix FNeg pattern matching 2020-05-01 22:00:57 +03:00
Nekotekina cda8b3a59e RSX: fix new warnings 2020-05-01 22:00:57 +03:00
Nekotekina 31035608ee Use utils::get_cpu_brand when applicable 2020-05-01 22:00:57 +03:00
Nekotekina f6200ba635 Implement thread_ctrl::get_process_affinity_mask() 2020-05-01 22:00:56 +03:00
Malcolm Jestadt c1bd154bcd SPU: Optimize FMA ops with 0 addend 2020-05-01 17:52:10 +03:00
Megamouse a568c958af evdev: simplify evdevbutton madness a bit
I hope this doesn't regress anything
2020-05-01 12:03:06 +02:00
Megamouse 2de6a9bc44 evdev: revert facepalm change 2020-05-01 12:03:06 +02:00
466 changed files with 32777 additions and 11829 deletions
+35
View File
@@ -0,0 +1,35 @@
#!/bin/sh -ex
ccache -s # debug
# Pull all the submodules except llvm
# Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046
git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
# XXX Drop after Travis upgrades FreeBSD to 12.2 (see also .ci/install-freebsd.sh)
case $(${CXX:-c++} --version) in
*version\ 8.0.*)
fetch https://github.com/llvm/llvm-project/releases/download/llvmorg-10.0.0/libcxx-10.0.0.src.tar.xz
tar xf libcxx-10.0.0.src.tar.xz
export CC=clang10 CXX=clang++10
export CXXFLAGS="$CXXFLAGS -nostdinc++ -isystem $PWD/libcxx-10.0.0.src/include"
;;
esac
CONFIGURE_ARGS="
-DCMAKE_C_COMPILER_LAUNCHER=ccache
-DCMAKE_CXX_COMPILER_LAUNCHER=ccache
-DWITH_LLVM=OFF
-DUSE_PRECOMPILED_HEADERS=OFF
-DUSE_NATIVE_INSTRUCTIONS=OFF
-DUSE_SYSTEM_FFMPEG=ON
-DUSE_SYSTEM_CURL=ON
-DUSE_SYSTEM_LIBPNG=ON
"
# shellcheck disable=SC2086
cmake -B build -G Ninja $CONFIGURE_ARGS
cmake --build build
ccache -s # debug
+2 -2
View File
@@ -25,8 +25,8 @@ if [ "$COMPILER" = "gcc" ]; then
export CXX=${GXX_BINARY} export CXX=${GXX_BINARY}
export LINKER=gold export LINKER=gold
# We need to set the following variables for LTO to link properly # We need to set the following variables for LTO to link properly
export AR=/usr/bin/gcc-ar-9 export AR=/usr/bin/gcc-ar-$GCCVER
export RANLIB=/usr/bin/gcc-ranlib-9 export RANLIB=/usr/bin/gcc-ranlib-$GCCVER
export CFLAGS="-fuse-linker-plugin" export CFLAGS="-fuse-linker-plugin"
else else
export CC=${CLANG_BINARY} export CC=${CLANG_BINARY}
+4
View File
@@ -0,0 +1,4 @@
#!/bin/sh -ex
curl -L -o "./llvm.lock" "https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z.sha256"
curl -L -o "./glslang.lock" "https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z.sha256"
+44
View File
@@ -0,0 +1,44 @@
#!/bin/sh -ex
ARTIFACT_DIR="$BUILD_ARTIFACTSTAGINGDIRECTORY"
generate_post_data()
{
body=$(cat GitHubReleaseMessage.txt)
cat <<EOF
{
"tag_name": "build-${BUILD_SOURCEVERSION}",
"target_commitish": "7d09e3be30805911226241afbb14f8cdc2eb054e",
"name": "${AVVER}",
"body": "$body",
"draft": false,
"prerelease": false
}
EOF
}
repo_full_name="RPCS3/rpcs3-binaries-win"
curl -s \
-H "Authorization: token ${RPCS3_TOKEN}" \
-H "Accept: application/vnd.github.v3+json" \
--data "$(generate_post_data)" "https://api.github.com/repos/$repo_full_name/releases" >> release.json
cat release.json
id=$(grep '"id"' release.json | cut -d ':' -f2 | head -n1 | awk '{$1=$1;print}')
id=${id%?}
echo ${id:?}
upload_file()
{
curl -s \
-H "Authorization: token ${RPCS3_TOKEN}" \
-H "Accept: application/vnd.github.v3+json" \
-H "Content-Type: application/octet-stream" \
--data-binary @"$2"/"$3" \
"https://uploads.github.com/repos/$repo_full_name/releases/$1/assets?name=$3"
}
for file in "$ARTIFACT_DIR"/*; do
name=$(basename "$file")
upload_file "$id" "$ARTIFACT_DIR" "$name"
done
+22
View File
@@ -0,0 +1,22 @@
#!/usr/bin/env -S su -m root -ex
# NOTE: this script is run under root permissions
# shellcheck shell=sh disable=SC2096
# RPCS3 often needs recent Qt5 and Vulkan-Headers
sed -i '' 's/quarterly/latest/' /etc/pkg/FreeBSD.conf
export ASSUME_ALWAYS_YES=true
pkg info # debug
# XXX Drop after Travis upgrades FreeBSD to 12.2 (see also .ci/build-freebsd.sh)
case $(${CXX:-c++} --version) in
*version\ 8.0.*)
pkg install llvm10
;;
esac
# Mandatory dependencies (qt5-dbus and qt5-gui are pulled via qt5-widgets)
pkg install git ccache cmake ninja qt5-qmake qt5-buildtools qt5-widgets qt5-concurrent glew openal-soft ffmpeg
# Optional dependencies (libevdev is pulled by qt5-gui)
pkg install pkgconf alsa-lib pulseaudio sdl2 evdev-proto vulkan-headers vulkan-loader
+8 -6
View File
@@ -7,8 +7,8 @@ PR_NUMBER="$SYSTEM_PULLREQUEST_PULLREQUESTID"
# Resource/dependency URLs # Resource/dependency URLs
# Qt mirrors can be volatile and slow, so we list 2 # Qt mirrors can be volatile and slow, so we list 2
#QT_HOST="http://mirrors.ocf.berkeley.edu/qt/" QT_HOST="http://mirrors.ocf.berkeley.edu/qt/"
QT_HOST="http://qt.mirror.constant.com/" #QT_HOST="http://qt.mirror.constant.com/"
QT_URL_VER=$(echo "$QT_VER" | sed "s/\.//g") QT_URL_VER=$(echo "$QT_VER" | sed "s/\.//g")
QT_PREFIX="online/qtsdkrepository/windows_x86/desktop/qt5_${QT_URL_VER}/qt.qt5.${QT_URL_VER}.win64_msvc2017_64/${QT_VER}-0-${QT_DATE}" QT_PREFIX="online/qtsdkrepository/windows_x86/desktop/qt5_${QT_URL_VER}/qt.qt5.${QT_URL_VER}.win64_msvc2017_64/${QT_VER}-0-${QT_DATE}"
QT_SUFFIX="-Windows-Windows_10-MSVC2017-Windows-Windows_10-X86_64.7z" QT_SUFFIX="-Windows-Windows_10-MSVC2017-Windows-Windows_10-X86_64.7z"
@@ -17,8 +17,9 @@ QT_WINE_URL="${QT_HOST}${QT_PREFIX}qtwinextras${QT_SUFFIX}"
QT_DECL_URL="${QT_HOST}${QT_PREFIX}qtdeclarative${QT_SUFFIX}" QT_DECL_URL="${QT_HOST}${QT_PREFIX}qtdeclarative${QT_SUFFIX}"
QT_TOOL_URL="${QT_HOST}${QT_PREFIX}qttools${QT_SUFFIX}" QT_TOOL_URL="${QT_HOST}${QT_PREFIX}qttools${QT_SUFFIX}"
LLVMLIBS_URL='https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z' LLVMLIBS_URL='https://github.com/RPCS3/llvm-mirror/releases/download/custom-build-win/llvmlibs_mt.7z'
GLSLANG_URL='https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z' #GLSLANG_URL='https://github.com/RPCS3/glslang/releases/download/custom-build-win/glslanglibs_mt.7z' <- Temporarily disabled auto-builds
VULKAN_SDK_URL="https://sdk.lunarg.com/sdk/download/${VULKAN_VER}/windows/VulkanSDK-${VULKAN_VER}-Installer.exe" GLSLANG_URL='https://www.dropbox.com/s/cg48qr4zmnn066v/glslanglibs_mt.7z'
VULKAN_SDK_URL="https://www.dropbox.com/s/adanclixregbp2x/VulkanSDK-${VULKAN_VER}-Installer.exe"
DEP_URLS=" \ DEP_URLS=" \
$QT_BASE_URL \ $QT_BASE_URL \
@@ -35,7 +36,7 @@ DEP_URLS=" \
# Pull all the submodules except llvm, since it is built separately and we just download that build # Pull all the submodules except llvm, since it is built separately and we just download that build
# Note: Tried to use git submodule status, but it takes over 20 seconds # Note: Tried to use git submodule status, but it takes over 20 seconds
# shellcheck disable=SC2046 # shellcheck disable=SC2046
git submodule -q update --init $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules) git submodule -q update --init --depth 1 $(awk '/path/ && !/llvm/ { print $3 }' .gitmodules)
# Git bash doesn't have rev, so here it is # Git bash doesn't have rev, so here it is
rev() rev()
@@ -75,7 +76,8 @@ for url in $DEP_URLS; do
case "$url" in case "$url" in
*qt*) checksum=$(curl -L "${url}.sha1"); algo="sha1"; outDir='C:\Qt\' ;; *qt*) checksum=$(curl -L "${url}.sha1"); algo="sha1"; outDir='C:\Qt\' ;;
*llvm*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="." ;; *llvm*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="." ;;
*glslang*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="./lib/Release - LLVM-x64" ;; #*glslang*) checksum=$(curl -L "${url}.sha256"); algo="sha256"; outDir="./lib/Release - LLVM-x64" ;; <- Temporarily disabled auto-build
*glslang*) checksum=$(curl -L 'https://www.dropbox.com/s/hwnatk68n70jap0/glslanglibs_mt.7z.sha256'); algo="sha256"; outDir="./lib/Release - LLVM-x64" ;;
*Vulkan*) *Vulkan*)
# Vulkan setup needs to be run in batch environment # Vulkan setup needs to be run in batch environment
# Need to subshell this or else it doesn't wait # Need to subshell this or else it doesn't wait
+19
View File
@@ -0,0 +1,19 @@
env:
CIRRUS_CLONE_DEPTH: 0 # Unshallow clone to obtain proper GIT_VERSION
freebsd_task:
matrix:
- name: FreeBSD 12.2 (snapshot)
freebsd_instance:
image_family: freebsd-12-1-snap
cpu: 8
memory: 8G
env:
CCACHE_MAXSIZE: 300M # 3x clean build, rounded
CCACHE_DIR: /tmp/ccache_dir
ccache_cache:
folder: /tmp/ccache_dir
packages_cache:
folder: /var/cache/pkg
install_script: "sh -ex ./.ci/install-freebsd.sh"
script: "./.ci/build-freebsd.sh"
+48 -14
View File
@@ -1,28 +1,62 @@
--- ---
name: Regression report name: Regression report
about: If something worked before, but now it doesn't about: If something used to work before, but now it doesn't
title: '' title: ''
labels: '' labels: ''
assignees: '' assignees: ''
--- ---
<!--- ## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
Please do not ask for help or report compatibility regressions here, use RPCS3 Discord server or forums instead.
Please read Contributing guide under Helpful resources on the right. →
--->
## Quick summary ## Quick summary
Please describe what exactly has stopped working correctly Please briefly describe what has stopped working correctly.
## Details ## Details
Please provide _exact_ build (or commit) information that introduced the regression you're reporting. Please describe the regression as accurately as possible.
Please see How to find the build that caused a regression in wiki: https://wiki.rpcs3.net/index.php?title=Help:Using_different_versions_of_RPCS3#How_to_find_the_build_that_caused_a_regression.3F
You can find old builds here: https://rpcs3.net/compatibility?b
Please remember to attach TWO logs: one for the build that exhibits regression, and one for the previous build that works as expected. #### 1. Please provide _exact_ build (or commit) information that introduced the regression you're reporting.
* Please see [How to find the build that caused a regression](https://wiki.rpcs3.net/index.php?title=Help:Using_different_versions_of_RPCS3#How_to_find_the_build_that_caused_a_regression.3F) in our wiki.
* You can find [History of RPCS3 builds](https://rpcs3.net/compatibility?b) here.
If the regression caused a graphical issue, please provide RSX capture and a Renderdoc capture that demonstrate the issue. #### 2. Please attach TWO logs:
To create an RSX capture, enable Debugger view (View → Show Debugger) and use the RSX Capture button. Captues will be stored in RPCS3 folder → captures. * One for the build with regression.
To create Renderdoc capture, please refer to Renderdoc documentation https://renderdoc.org/docs/how/how_capture_frame.html * One for the build that works as expected.
##### How to obtain RPCS3's log:
* Run the game until you find the regression.
* Completely close RPCS3, or move to the next step in case it has crashed.
* Locate RPCS3's log file:
+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
or
+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
On Linux it will be in ```~/.cache/rpcs3/```.
On Windows it will be near the executable.
* Attach the log:
+ Drag and drop your log file into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
#### 3. If you describe graphical regression, please provide an RSX capture and a RenderDoc capture that demonstrate it.
* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
Captures will be stored in RPCS3 folder → captures.
+ Compress your capture with 7z, Rar etc.
And drag and drop it into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
#### 4. Please attach screenshots of your problem.
* Enable performance overlay with at least medium level of detail.
You can find it in _Emulator_ tab in _Settings_.
#### 5. Please provide comparison with real PS3.
#### 6. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
+42 -13
View File
@@ -7,20 +7,49 @@ assignees: ''
--- ---
<!--- ## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
Please do not ask for help or general inquiry here, use RPCS3 Discord server instead.
Please read Contributing guide under Helpful resources on the right. →
--->
## Quick summary ## Quick summary
Please summarize the issue here Please briefly describe what is not working correctly.
## Details ## Details
Please provide as much detail as you can here, including
- expected (real hw) and observed (emulator) behavior Please describe the problem as accurately as possible.
- full logs (not from UI)
- back traces (for hard crashes) #### 1. Please attach RPCS3's log.
- screenshots, Renderdoc, and RSX captures (for visual issues) * Run the game until you find the issue.
- your system configuration (OS, CPU, GPU, driver versions, etc) * Completely close RPCS3, or move to the next step in case it has crashed.
- anything else you deem to be important * Locate RPCS3's log file:
+ ```RPCS3.log``` (It can show up as just RPCS3 and have a notepad icon)
or
+ ```RPCS3.log.gz``` (It can show up as RPCS3.log and have a zip or rar icon)
![image](https://user-images.githubusercontent.com/44116740/84433247-aa15fa80-ac36-11ea-913e-6fe25a1d040e.png)
On Linux it will be in ```~/.cache/rpcs3/```.
On Windows it will be near the executable.
* Attach the log:
+ Drag and drop your log file into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
#### 2. If you describe graphical issue, please provide an RSX capture and a RenderDoc capture that demonstrate it.
* To create an RSX capture, use _Create_ _RSX_ _Capture_ under _Utilities_.
Captures will be stored in RPCS3 folder → captures.
+ Compress your capture with 7z, Rar etc.
And drag and drop it into the issue.
+ Or upload it to the cloud, such as Dropbox, Mega etc.
* To create a RenderDoc capture, please refer to [RenderDoc's documentation](https://renderdoc.org/docs/how/how_capture_frame.html).
#### 3. Please attach screenshots of your problem.
* Enable performance overlay with at least medium level of detail.
You can find it in _Emulator_ tab in _Settings_.
#### 4. Please provide comparison with real PS3.
#### 5. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
@@ -0,0 +1,41 @@
---
name: Feature Request
about: If RPCS3 lacks a feature you would like to see
title: '[Feature Request] Enter Feature Title Here'
labels: ''
assignees: ''
---
## Please do not ask for help or report compatibility regressions here, use [RPCS3 Discord server](https://discord.me/RPCS3) or [forums](https://forums.rpcs3.net/) instead.
## Quick summary
Please briefly describe what feature you would like RPCS3 to have.
## Details
Please describe the feature as accurately as possible.
#### 1. Please describe, what part of RPCS3 would be affected by your feature:
* Gameplay
* Debugging
* UI
* Patches
* Installation
* Github
* CI
* etc.
#### 2. Please tell us, why your feature is important to RPCS3.
#### 3. Please attach screenshots of the feature implemented in other projects.
#### 4. Please provide your system configuration:
* OS
* CPU
* GPU
* Driver version
* etc.
#### Please include.
* Anything else you deem to be important
+1
View File
@@ -40,6 +40,7 @@
/3rdparty/llvm_build /3rdparty/llvm_build
/Vulkan/Vulkan-build /Vulkan/Vulkan-build
/Vulkan/glslang-build /Vulkan/glslang-build
/Vulkan/spirv-tools-build
!/bin !/bin
/bin/* /bin/*
+12 -1
View File
@@ -14,6 +14,14 @@
path = Vulkan/glslang path = Vulkan/glslang
url = https://github.com/KhronosGroup/glslang.git url = https://github.com/KhronosGroup/glslang.git
ignore = dirty ignore = dirty
[submodule "Vulkan/spirv-tools"]
path = Vulkan/spirv-tools
url = https://github.com/KhronosGroup/SPIRV-Tools.git
ignore = dirty
[submodule "Vulkan/spirv-headers"]
path = Vulkan/spirv-headers
url = https://github.com/KhronosGroup/SPIRV-Headers.git
ignore = dirty
[submodule "3rdparty/cereal"] [submodule "3rdparty/cereal"]
path = 3rdparty/cereal path = 3rdparty/cereal
url = https://github.com/RPCS3/cereal.git url = https://github.com/RPCS3/cereal.git
@@ -63,4 +71,7 @@
path = 3rdparty/wolfssl path = 3rdparty/wolfssl
url = https://github.com/RipleyTom/wolfssl.git url = https://github.com/RipleyTom/wolfssl.git
ignore = dirty ignore = dirty
[submodule "3rdparty/flatbuffers"]
path = 3rdparty/flatbuffers
url = https://github.com/google/flatbuffers.git
ignore = dirty
-3
View File
@@ -1,3 +0,0 @@
{
"userBlacklist": ["AlexAltea", "tambry", "DHrpcs3"]
}
+9 -4
View File
@@ -10,8 +10,8 @@ jobs:
services: docker services: docker
cache: ccache cache: ccache
compiler: gcc compiler: gcc
install: "docker pull rpcs3/rpcs3-travis-xenial:1.2" install: "docker pull rpcs3/rpcs3-travis-xenial:1.5"
script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.2 /rpcs3/.ci/build-linux.sh' script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.5 /rpcs3/.ci/build-linux.sh'
- os: linux - os: linux
dist: xenial dist: xenial
env: env:
@@ -20,8 +20,13 @@ jobs:
services: docker services: docker
cache: ccache cache: ccache
compiler: clang compiler: clang
install: "docker pull rpcs3/rpcs3-travis-xenial:1.2" install: "docker pull rpcs3/rpcs3-travis-xenial:1.5"
script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.2 /rpcs3/.ci/build-linux.sh' script: 'travis_wait docker run -v $(pwd):/rpcs3 -v "$HOME/.ccache":/root/.ccache --env-file .ci/travis.env rpcs3/rpcs3-travis-xenial:1.5 /rpcs3/.ci/build-linux.sh'
# - os: freebsd
# compiler: clang
# cache: ccache
# install: "./.ci/install-freebsd.sh"
# script: "./.ci/build-freebsd.sh"
# - os: osx # - os: osx
# osx_image: xcode11.3 # osx_image: xcode11.3
# addons: # addons:
+3
View File
@@ -111,6 +111,9 @@
</PropertyGroup> </PropertyGroup>
<Import Project="..\common_default.props" /> <Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<Import Project="..\common_default_macros.props" /> <Import Project="..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|Win32'" Label="Configuration"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|Win32'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType> <ConfigurationType>StaticLibrary</ConfigurationType>
+8 -3
View File
@@ -74,6 +74,9 @@ else()
add_library(3rdparty_7z INTERFACE) add_library(3rdparty_7z INTERFACE)
endif() endif()
add_library(3rdparty_flatbuffers INTERFACE)
target_include_directories(3rdparty_flatbuffers INTERFACE flatbuffers/include)
# libPNG # libPNG
# Select the version of libpng to use, default is builtin # Select the version of libpng to use, default is builtin
if (NOT USE_SYSTEM_LIBPNG) if (NOT USE_SYSTEM_LIBPNG)
@@ -297,7 +300,7 @@ if(USE_VULKAN)
if(VULKAN_FOUND) if(VULKAN_FOUND)
add_library(3rdparty_vulkan INTERFACE) add_library(3rdparty_vulkan INTERFACE)
target_compile_definitions(3rdparty_vulkan INTERFACE -DHAVE_VULKAN) target_compile_definitions(3rdparty_vulkan INTERFACE -DHAVE_VULKAN)
target_link_libraries(3rdparty_vulkan INTERFACE SPIRV Vulkan::Vulkan) target_link_libraries(3rdparty_vulkan INTERFACE SPIRV SPIRV-Tools-opt Vulkan::Vulkan)
if(UNIX AND NOT APPLE) if(UNIX AND NOT APPLE)
find_package(Wayland) find_package(Wayland)
@@ -413,16 +416,17 @@ endif()
# LLVM # LLVM
include(llvm.cmake) include(llvm.cmake)
# WOLFSSL
add_subdirectory(wolfssl EXCLUDE_FROM_ALL)
# CURL # CURL
if(USE_SYSTEM_CURL) if(USE_SYSTEM_CURL)
message("-- RPCS3: using shared libcurl") message("-- RPCS3: using shared libcurl")
find_package(CURL REQUIRED) find_package(CURL REQUIRED)
add_library(wolfssl-3-static INTERFACE)
add_library(libcurl INTERFACE) add_library(libcurl INTERFACE)
target_link_libraries(libcurl INTERFACE CURL::libcurl) target_link_libraries(libcurl INTERFACE CURL::libcurl)
else() else()
message("-- RPCS3: building libcurl + wolfssl submodules") message("-- RPCS3: building libcurl + wolfssl submodules")
add_subdirectory(wolfssl EXCLUDE_FROM_ALL)
add_subdirectory(curl EXCLUDE_FROM_ALL) add_subdirectory(curl EXCLUDE_FROM_ALL)
endif() endif()
@@ -430,6 +434,7 @@ endif()
add_library(3rdparty::libusb ALIAS usb-1.0-static) add_library(3rdparty::libusb ALIAS usb-1.0-static)
add_library(3rdparty::zlib ALIAS 3rdparty_zlib) add_library(3rdparty::zlib ALIAS 3rdparty_zlib)
add_library(3rdparty::7z ALIAS 3rdparty_7z) add_library(3rdparty::7z ALIAS 3rdparty_7z)
add_library(3rdparty::flatbuffers ALIAS 3rdparty_flatbuffers)
add_library(3rdparty::pugixml ALIAS pugixml) add_library(3rdparty::pugixml ALIAS pugixml)
add_library(3rdparty::yaml-cpp ALIAS yaml-cpp) add_library(3rdparty::yaml-cpp ALIAS yaml-cpp)
add_library(3rdparty::xxhash ALIAS xxhash) add_library(3rdparty::xxhash ALIAS xxhash)
+383 -77
View File
@@ -1,12 +1,12 @@
#ifndef __glext_h_ #ifndef __gl_glext_h_
#define __glext_h_ 1 #define __gl_glext_h_ 1
#ifdef __cplusplus #ifdef __cplusplus
extern "C" { extern "C" {
#endif #endif
/* /*
** Copyright (c) 2013-2017 The Khronos Group Inc. ** Copyright (c) 2013-2018 The Khronos Group Inc.
** **
** Permission is hereby granted, free of charge, to any person obtaining a ** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the ** copy of this software and/or associated documentation files (the
@@ -51,7 +51,9 @@ extern "C" {
#define GLAPI extern #define GLAPI extern
#endif #endif
#define GL_GLEXT_VERSION 20180114 #define GL_GLEXT_VERSION 20200423
#include "khrplatform.h"
/* Generated C header for: /* Generated C header for:
* API: gl * API: gl
@@ -464,9 +466,8 @@ GLAPI void APIENTRY glBlendEquation (GLenum mode);
#ifndef GL_VERSION_1_5 #ifndef GL_VERSION_1_5
#define GL_VERSION_1_5 1 #define GL_VERSION_1_5 1
#include <stddef.h> typedef khronos_ssize_t GLsizeiptr;
typedef ptrdiff_t GLsizeiptr; typedef khronos_intptr_t GLintptr;
typedef ptrdiff_t GLintptr;
#define GL_BUFFER_SIZE 0x8764 #define GL_BUFFER_SIZE 0x8764
#define GL_BUFFER_USAGE 0x8765 #define GL_BUFFER_USAGE 0x8765
#define GL_QUERY_COUNTER_BITS 0x8864 #define GL_QUERY_COUNTER_BITS 0x8864
@@ -879,7 +880,7 @@ GLAPI void APIENTRY glUniformMatrix4x3fv (GLint location, GLsizei count, GLboole
#ifndef GL_VERSION_3_0 #ifndef GL_VERSION_3_0
#define GL_VERSION_3_0 1 #define GL_VERSION_3_0 1
typedef unsigned short GLhalf; typedef khronos_uint16_t GLhalf;
#define GL_COMPARE_REF_TO_TEXTURE 0x884E #define GL_COMPARE_REF_TO_TEXTURE 0x884E
#define GL_CLIP_DISTANCE0 0x3000 #define GL_CLIP_DISTANCE0 0x3000
#define GL_CLIP_DISTANCE1 0x3001 #define GL_CLIP_DISTANCE1 0x3001
@@ -1383,45 +1384,8 @@ GLAPI void APIENTRY glUniformBlockBinding (GLuint program, GLuint uniformBlockIn
#ifndef GL_VERSION_3_2 #ifndef GL_VERSION_3_2
#define GL_VERSION_3_2 1 #define GL_VERSION_3_2 1
typedef struct __GLsync *GLsync; typedef struct __GLsync *GLsync;
#ifndef GLEXT_64_TYPES_DEFINED typedef khronos_uint64_t GLuint64;
/* This code block is duplicated in glxext.h, so must be protected */ typedef khronos_int64_t GLint64;
#define GLEXT_64_TYPES_DEFINED
/* Define int32_t, int64_t, and uint64_t types for UST/MSC */
/* (as used in the GL_EXT_timer_query extension). */
#if defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L
#include <inttypes.h>
#elif defined(__sun__) || defined(__digital__)
#include <inttypes.h>
#if defined(__STDC__)
#if defined(__arch64__) || defined(_LP64)
typedef long int int64_t;
typedef unsigned long int uint64_t;
#else
typedef long long int int64_t;
typedef unsigned long long int uint64_t;
#endif /* __arch64__ */
#endif /* __STDC__ */
#elif defined( __VMS ) || defined(__sgi)
#include <inttypes.h>
#elif defined(__SCO__) || defined(__USLC__)
#include <stdint.h>
#elif defined(__UNIXOS2__) || defined(__SOL64__)
typedef long int int32_t;
typedef long long int int64_t;
typedef unsigned long long int uint64_t;
#elif defined(_WIN32) && defined(__GNUC__)
#include <stdint.h>
#elif defined(_WIN32)
typedef __int32 int32_t;
typedef __int64 int64_t;
typedef unsigned __int64 uint64_t;
#else
/* Fallback if nothing above works */
#include <inttypes.h>
#endif
#endif
typedef uint64_t GLuint64;
typedef int64_t GLint64;
#define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001 #define GL_CONTEXT_CORE_PROFILE_BIT 0x00000001
#define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002 #define GL_CONTEXT_COMPATIBILITY_PROFILE_BIT 0x00000002
#define GL_LINES_ADJACENCY 0x000A #define GL_LINES_ADJACENCY 0x000A
@@ -1497,7 +1461,7 @@ typedef void (APIENTRYP PFNGLDELETESYNCPROC) (GLsync sync);
typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); typedef GLenum (APIENTRYP PFNGLCLIENTWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout); typedef void (APIENTRYP PFNGLWAITSYNCPROC) (GLsync sync, GLbitfield flags, GLuint64 timeout);
typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data); typedef void (APIENTRYP PFNGLGETINTEGER64VPROC) (GLenum pname, GLint64 *data);
typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLGETSYNCIVPROC) (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data); typedef void (APIENTRYP PFNGLGETINTEGER64I_VPROC) (GLenum target, GLuint index, GLint64 *data);
typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params); typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERI64VPROC) (GLenum target, GLenum pname, GLint64 *params);
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level); typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTUREPROC) (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1517,7 +1481,7 @@ GLAPI void APIENTRY glDeleteSync (GLsync sync);
GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); GLAPI GLenum APIENTRY glClientWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout); GLAPI void APIENTRY glWaitSync (GLsync sync, GLbitfield flags, GLuint64 timeout);
GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data); GLAPI void APIENTRY glGetInteger64v (GLenum pname, GLint64 *data);
GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); GLAPI void APIENTRY glGetSynciv (GLsync sync, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data); GLAPI void APIENTRY glGetInteger64i_v (GLenum target, GLuint index, GLint64 *data);
GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params); GLAPI void APIENTRY glGetBufferParameteri64v (GLenum target, GLenum pname, GLint64 *params);
GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level); GLAPI void APIENTRY glFramebufferTexture (GLenum target, GLenum attachment, GLuint texture, GLint level);
@@ -1773,8 +1737,8 @@ typedef void (APIENTRYP PFNGLGETUNIFORMDVPROC) (GLuint program, GLint location,
typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETSUBROUTINEUNIFORMLOCATIONPROC) (GLuint program, GLenum shadertype, const GLchar *name);
typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name); typedef GLuint (APIENTRYP PFNGLGETSUBROUTINEINDEXPROC) (GLuint program, GLenum shadertype, const GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMIVPROC) (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINEUNIFORMNAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); typedef void (APIENTRYP PFNGLGETACTIVESUBROUTINENAMEPROC) (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices); typedef void (APIENTRYP PFNGLUNIFORMSUBROUTINESUIVPROC) (GLenum shadertype, GLsizei count, const GLuint *indices);
typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params); typedef void (APIENTRYP PFNGLGETUNIFORMSUBROUTINEUIVPROC) (GLenum shadertype, GLint location, GLuint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values); typedef void (APIENTRYP PFNGLGETPROGRAMSTAGEIVPROC) (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -1820,8 +1784,8 @@ GLAPI void APIENTRY glGetUniformdv (GLuint program, GLint location, GLdouble *pa
GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name); GLAPI GLint APIENTRY glGetSubroutineUniformLocation (GLuint program, GLenum shadertype, const GLchar *name);
GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name); GLAPI GLuint APIENTRY glGetSubroutineIndex (GLuint program, GLenum shadertype, const GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values); GLAPI void APIENTRY glGetActiveSubroutineUniformiv (GLuint program, GLenum shadertype, GLuint index, GLenum pname, GLint *values);
GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); GLAPI void APIENTRY glGetActiveSubroutineUniformName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufsize, GLsizei *length, GLchar *name); GLAPI void APIENTRY glGetActiveSubroutineName (GLuint program, GLenum shadertype, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices); GLAPI void APIENTRY glUniformSubroutinesuiv (GLenum shadertype, GLsizei count, const GLuint *indices);
GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params); GLAPI void APIENTRY glGetUniformSubroutineuiv (GLenum shadertype, GLint location, GLuint *params);
GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values); GLAPI void APIENTRY glGetProgramStageiv (GLuint program, GLenum shadertype, GLenum pname, GLint *values);
@@ -2175,7 +2139,7 @@ GLAPI void APIENTRY glGetDoublei_v (GLenum target, GLuint index, GLdouble *data)
typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWARRAYSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); typedef void (APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXBASEINSTANCEPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETINTERNALFORMATIVPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETACTIVEATOMICCOUNTERBUFFERIVPROC) (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); typedef void (APIENTRYP PFNGLBINDIMAGETEXTUREPROC) (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers); typedef void (APIENTRYP PFNGLMEMORYBARRIERPROC) (GLbitfield barriers);
@@ -2188,7 +2152,7 @@ typedef void (APIENTRYP PFNGLDRAWTRANSFORMFEEDBACKSTREAMINSTANCEDPROC) (GLenum m
GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawArraysInstancedBaseInstance (GLenum mode, GLint first, GLsizei count, GLsizei instancecount, GLuint baseinstance);
GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLuint baseinstance);
GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance); GLAPI void APIENTRY glDrawElementsInstancedBaseVertexBaseInstance (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex, GLuint baseinstance);
GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetInternalformativ (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint *params);
GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params); GLAPI void APIENTRY glGetActiveAtomicCounterBufferiv (GLuint program, GLuint bufferIndex, GLenum pname, GLint *params);
GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format); GLAPI void APIENTRY glBindImageTexture (GLuint unit, GLuint texture, GLint level, GLboolean layered, GLint layer, GLenum access, GLenum format);
GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers); GLAPI void APIENTRY glMemoryBarrier (GLbitfield barriers);
@@ -2469,7 +2433,7 @@ typedef void (APIENTRYP PFNGLDISPATCHCOMPUTEINDIRECTPROC) (GLintptr indirect);
typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLCOPYIMAGESUBDATAPROC) (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param); typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); typedef void (APIENTRYP PFNGLGETINTERNALFORMATI64VPROC) (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); typedef void (APIENTRYP PFNGLINVALIDATETEXSUBIMAGEPROC) (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level); typedef void (APIENTRYP PFNGLINVALIDATETEXIMAGEPROC) (GLuint texture, GLint level);
typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length); typedef void (APIENTRYP PFNGLINVALIDATEBUFFERSUBDATAPROC) (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2481,7 +2445,7 @@ typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTPROC) (GLenum mode, GLenum
typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMINTERFACEIVPROC) (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef GLuint (APIENTRYP PFNGLGETPROGRAMRESOURCEINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCENAMEPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEIVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name); typedef GLint (APIENTRYP PFNGLGETPROGRAMRESOURCELOCATIONINDEXPROC) (GLuint program, GLenum programInterface, const GLchar *name);
typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); typedef void (APIENTRYP PFNGLSHADERSTORAGEBLOCKBINDINGPROC) (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2513,7 +2477,7 @@ GLAPI void APIENTRY glDispatchComputeIndirect (GLintptr indirect);
GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glCopyImageSubData (GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth);
GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param); GLAPI void APIENTRY glFramebufferParameteri (GLenum target, GLenum pname, GLint param);
GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params); GLAPI void APIENTRY glGetFramebufferParameteriv (GLenum target, GLenum pname, GLint *params);
GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei bufSize, GLint64 *params); GLAPI void APIENTRY glGetInternalformati64v (GLenum target, GLenum internalformat, GLenum pname, GLsizei count, GLint64 *params);
GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth); GLAPI void APIENTRY glInvalidateTexSubImage (GLuint texture, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth);
GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level); GLAPI void APIENTRY glInvalidateTexImage (GLuint texture, GLint level);
GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length); GLAPI void APIENTRY glInvalidateBufferSubData (GLuint buffer, GLintptr offset, GLsizeiptr length);
@@ -2525,7 +2489,7 @@ GLAPI void APIENTRY glMultiDrawElementsIndirect (GLenum mode, GLenum type, const
GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params); GLAPI void APIENTRY glGetProgramInterfaceiv (GLuint program, GLenum programInterface, GLenum pname, GLint *params);
GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name); GLAPI GLuint APIENTRY glGetProgramResourceIndex (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name); GLAPI void APIENTRY glGetProgramResourceName (GLuint program, GLenum programInterface, GLuint index, GLsizei bufSize, GLsizei *length, GLchar *name);
GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLint *params); GLAPI void APIENTRY glGetProgramResourceiv (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLint *params);
GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name); GLAPI GLint APIENTRY glGetProgramResourceLocation (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name); GLAPI GLint APIENTRY glGetProgramResourceLocationIndex (GLuint program, GLenum programInterface, const GLchar *name);
GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding); GLAPI void APIENTRY glShaderStorageBlockBinding (GLuint program, GLuint storageBlockIndex, GLuint storageBlockBinding);
@@ -2936,7 +2900,7 @@ GLAPI void APIENTRY glPrimitiveBoundingBoxARB (GLfloat minX, GLfloat minY, GLflo
#ifndef GL_ARB_bindless_texture #ifndef GL_ARB_bindless_texture
#define GL_ARB_bindless_texture 1 #define GL_ARB_bindless_texture 1
typedef uint64_t GLuint64EXT; typedef khronos_uint64_t GLuint64EXT;
#define GL_UNSIGNED_INT64_ARB 0x140F #define GL_UNSIGNED_INT64_ARB 0x140F
typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture); typedef GLuint64 (APIENTRYP PFNGLGETTEXTUREHANDLEARBPROC) (GLuint texture);
typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler); typedef GLuint64 (APIENTRYP PFNGLGETTEXTURESAMPLERHANDLEARBPROC) (GLuint texture, GLuint sampler);
@@ -3496,7 +3460,7 @@ GLAPI void APIENTRY glProgramUniform4ui64vARB (GLuint program, GLint location, G
#ifndef GL_ARB_half_float_pixel #ifndef GL_ARB_half_float_pixel
#define GL_ARB_half_float_pixel 1 #define GL_ARB_half_float_pixel 1
typedef unsigned short GLhalfARB; typedef khronos_uint16_t GLhalfARB;
#define GL_HALF_FLOAT_ARB 0x140B #define GL_HALF_FLOAT_ARB 0x140B
#endif /* GL_ARB_half_float_pixel */ #endif /* GL_ARB_half_float_pixel */
@@ -3666,6 +3630,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor);
#ifndef GL_ARB_internalformat_query2 #ifndef GL_ARB_internalformat_query2
#define GL_ARB_internalformat_query2 1 #define GL_ARB_internalformat_query2 1
#define GL_SRGB_DECODE_ARB 0x8299 #define GL_SRGB_DECODE_ARB 0x8299
#define GL_VIEW_CLASS_EAC_R11 0x9383
#define GL_VIEW_CLASS_EAC_RG11 0x9384
#define GL_VIEW_CLASS_ETC2_RGB 0x9385
#define GL_VIEW_CLASS_ETC2_RGBA 0x9386
#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387
#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388
#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389
#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A
#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B
#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C
#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D
#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E
#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F
#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390
#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391
#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392
#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393
#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394
#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395
#endif /* GL_ARB_internalformat_query2 */ #endif /* GL_ARB_internalformat_query2 */
#ifndef GL_ARB_invalidate_subdata #ifndef GL_ARB_invalidate_subdata
@@ -4713,8 +4696,8 @@ GLAPI void APIENTRY glVertexBlendARB (GLint count);
#ifndef GL_ARB_vertex_buffer_object #ifndef GL_ARB_vertex_buffer_object
#define GL_ARB_vertex_buffer_object 1 #define GL_ARB_vertex_buffer_object 1
typedef ptrdiff_t GLsizeiptrARB; typedef khronos_ssize_t GLsizeiptrARB;
typedef ptrdiff_t GLintptrARB; typedef khronos_intptr_t GLintptrARB;
#define GL_BUFFER_SIZE_ARB 0x8764 #define GL_BUFFER_SIZE_ARB 0x8764
#define GL_BUFFER_USAGE_ARB 0x8765 #define GL_BUFFER_USAGE_ARB 0x8765
#define GL_ARRAY_BUFFER_ARB 0x8892 #define GL_ARRAY_BUFFER_ARB 0x8892
@@ -4909,6 +4892,12 @@ GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB programObj, const GLcha
#ifndef GL_ARB_viewport_array #ifndef GL_ARB_viewport_array
#define GL_ARB_viewport_array 1 #define GL_ARB_viewport_array 1
typedef void (APIENTRYP PFNGLDEPTHRANGEARRAYDVNVPROC) (GLuint first, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLDEPTHRANGEINDEXEDDNVPROC) (GLuint index, GLdouble n, GLdouble f);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDepthRangeArraydvNV (GLuint first, GLsizei count, const GLdouble *v);
GLAPI void APIENTRY glDepthRangeIndexeddNV (GLuint index, GLdouble n, GLdouble f);
#endif
#endif /* GL_ARB_viewport_array */ #endif /* GL_ARB_viewport_array */
#ifndef GL_ARB_window_pos #ifndef GL_ARB_window_pos
@@ -5009,6 +4998,22 @@ GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count);
#define GL_CONTEXT_ROBUST_ACCESS 0x90F3 #define GL_CONTEXT_ROBUST_ACCESS 0x90F3
#endif /* GL_KHR_robustness */ #endif /* GL_KHR_robustness */
#ifndef GL_KHR_shader_subgroup
#define GL_KHR_shader_subgroup 1
#define GL_SUBGROUP_SIZE_KHR 0x9532
#define GL_SUBGROUP_SUPPORTED_STAGES_KHR 0x9533
#define GL_SUBGROUP_SUPPORTED_FEATURES_KHR 0x9534
#define GL_SUBGROUP_QUAD_ALL_STAGES_KHR 0x9535
#define GL_SUBGROUP_FEATURE_BASIC_BIT_KHR 0x00000001
#define GL_SUBGROUP_FEATURE_VOTE_BIT_KHR 0x00000002
#define GL_SUBGROUP_FEATURE_ARITHMETIC_BIT_KHR 0x00000004
#define GL_SUBGROUP_FEATURE_BALLOT_BIT_KHR 0x00000008
#define GL_SUBGROUP_FEATURE_SHUFFLE_BIT_KHR 0x00000010
#define GL_SUBGROUP_FEATURE_SHUFFLE_RELATIVE_BIT_KHR 0x00000020
#define GL_SUBGROUP_FEATURE_CLUSTERED_BIT_KHR 0x00000040
#define GL_SUBGROUP_FEATURE_QUAD_BIT_KHR 0x00000080
#endif /* GL_KHR_shader_subgroup */
#ifndef GL_KHR_texture_compression_astc_hdr #ifndef GL_KHR_texture_compression_astc_hdr
#define GL_KHR_texture_compression_astc_hdr 1 #define GL_KHR_texture_compression_astc_hdr 1
#define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0 #define GL_COMPRESSED_RGBA_ASTC_4x4_KHR 0x93B0
@@ -5115,7 +5120,7 @@ GLAPI void APIENTRY glVertex4bvOES (const GLbyte *coords);
#ifndef GL_OES_fixed_point #ifndef GL_OES_fixed_point
#define GL_OES_fixed_point 1 #define GL_OES_fixed_point 1
typedef GLint GLfixed; typedef khronos_int32_t GLfixed;
#define GL_FIXED_OES 0x140C #define GL_FIXED_OES 0x140C
typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref); typedef void (APIENTRYP PFNGLALPHAFUNCXOESPROC) (GLenum func, GLfixed ref);
typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha); typedef void (APIENTRYP PFNGLCLEARCOLORXOESPROC) (GLfixed red, GLfixed green, GLfixed blue, GLfixed alpha);
@@ -5411,12 +5416,12 @@ typedef void (APIENTRY *GLDEBUGPROCAMD)(GLuint id,GLenum category,GLenum severi
typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); typedef void (APIENTRYP PFNGLDEBUGMESSAGEENABLEAMDPROC) (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); typedef void (APIENTRYP PFNGLDEBUGMESSAGEINSERTAMDPROC) (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam); typedef void (APIENTRYP PFNGLDEBUGMESSAGECALLBACKAMDPROC) (GLDEBUGPROCAMD callback, void *userParam);
typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); typedef GLuint (APIENTRYP PFNGLGETDEBUGMESSAGELOGAMDPROC) (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
#ifdef GL_GLEXT_PROTOTYPES #ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled); GLAPI void APIENTRY glDebugMessageEnableAMD (GLenum category, GLenum severity, GLsizei count, const GLuint *ids, GLboolean enabled);
GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf); GLAPI void APIENTRY glDebugMessageInsertAMD (GLenum category, GLenum severity, GLuint id, GLsizei length, const GLchar *buf);
GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam); GLAPI void APIENTRY glDebugMessageCallbackAMD (GLDEBUGPROCAMD callback, void *userParam);
GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufsize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message); GLAPI GLuint APIENTRY glGetDebugMessageLogAMD (GLuint count, GLsizei bufSize, GLenum *categories, GLuint *severities, GLuint *ids, GLsizei *lengths, GLchar *message);
#endif #endif
#endif /* GL_AMD_debug_output */ #endif /* GL_AMD_debug_output */
@@ -5440,6 +5445,22 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG
#endif #endif
#endif /* GL_AMD_draw_buffers_blend */ #endif /* GL_AMD_draw_buffers_blend */
#ifndef GL_AMD_framebuffer_multisample_advanced
#define GL_AMD_framebuffer_multisample_advanced 1
#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2
#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3
#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4
#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5
#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6
#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7
typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height);
#endif
#endif /* GL_AMD_framebuffer_multisample_advanced */
#ifndef GL_AMD_framebuffer_sample_positions #ifndef GL_AMD_framebuffer_sample_positions
#define GL_AMD_framebuffer_sample_positions 1 #define GL_AMD_framebuffer_sample_positions 1
#define GL_SUBSAMPLE_DISTANCE_AMD 0x883F #define GL_SUBSAMPLE_DISTANCE_AMD 0x883F
@@ -5485,7 +5506,7 @@ GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLe
#ifndef GL_AMD_gpu_shader_int64 #ifndef GL_AMD_gpu_shader_int64
#define GL_AMD_gpu_shader_int64 1 #define GL_AMD_gpu_shader_int64 1
typedef int64_t GLint64EXT; typedef khronos_int64_t GLint64EXT;
#define GL_INT64_NV 0x140E #define GL_INT64_NV 0x140E
#define GL_UNSIGNED_INT64_NV 0x140F #define GL_UNSIGNED_INT64_NV 0x140F
#define GL_INT8_NV 0x8FE0 #define GL_INT8_NV 0x8FE0
@@ -5704,6 +5725,10 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf
#define GL_AMD_shader_explicit_vertex_parameter 1 #define GL_AMD_shader_explicit_vertex_parameter 1
#endif /* GL_AMD_shader_explicit_vertex_parameter */ #endif /* GL_AMD_shader_explicit_vertex_parameter */
#ifndef GL_AMD_shader_gpu_shader_half_float_fetch
#define GL_AMD_shader_gpu_shader_half_float_fetch 1
#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */
#ifndef GL_AMD_shader_image_load_store_lod #ifndef GL_AMD_shader_image_load_store_lod
#define GL_AMD_shader_image_load_store_lod 1 #define GL_AMD_shader_image_load_store_lod 1
#endif /* GL_AMD_shader_image_load_store_lod */ #endif /* GL_AMD_shader_image_load_store_lod */
@@ -6451,6 +6476,21 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param);
#define GL_422_REV_AVERAGE_EXT 0x80CF #define GL_422_REV_AVERAGE_EXT 0x80CF
#endif /* GL_EXT_422_pixels */ #endif /* GL_EXT_422_pixels */
#ifndef GL_EXT_EGL_image_storage
#define GL_EXT_EGL_image_storage 1
typedef void *GLeglImageOES;
typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list);
typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list);
GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list);
#endif
#endif /* GL_EXT_EGL_image_storage */
#ifndef GL_EXT_EGL_sync
#define GL_EXT_EGL_sync 1
#endif /* GL_EXT_EGL_sync */
#ifndef GL_EXT_abgr #ifndef GL_EXT_abgr
#define GL_EXT_abgr 1 #define GL_EXT_abgr 1
#define GL_ABGR_EXT 0x8000 #define GL_ABGR_EXT 0x8000
@@ -7780,6 +7820,18 @@ GLAPI void APIENTRY glSamplePatternEXT (GLenum pattern);
#endif #endif
#endif /* GL_EXT_multisample */ #endif /* GL_EXT_multisample */
#ifndef GL_EXT_multiview_tessellation_geometry_shader
#define GL_EXT_multiview_tessellation_geometry_shader 1
#endif /* GL_EXT_multiview_tessellation_geometry_shader */
#ifndef GL_EXT_multiview_texture_multisample
#define GL_EXT_multiview_texture_multisample 1
#endif /* GL_EXT_multiview_texture_multisample */
#ifndef GL_EXT_multiview_timer_query
#define GL_EXT_multiview_timer_query 1
#endif /* GL_EXT_multiview_timer_query */
#ifndef GL_EXT_packed_depth_stencil #ifndef GL_EXT_packed_depth_stencil
#define GL_EXT_packed_depth_stencil 1 #define GL_EXT_packed_depth_stencil 1
#define GL_DEPTH_STENCIL_EXT 0x84F9 #define GL_DEPTH_STENCIL_EXT 0x84F9
@@ -8049,6 +8101,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin
#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA
#endif /* GL_EXT_separate_specular_color */ #endif /* GL_EXT_separate_specular_color */
#ifndef GL_EXT_shader_framebuffer_fetch
#define GL_EXT_shader_framebuffer_fetch 1
#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52
#endif /* GL_EXT_shader_framebuffer_fetch */
#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent
#define GL_EXT_shader_framebuffer_fetch_non_coherent 1
typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void);
#endif
#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */
#ifndef GL_EXT_shader_image_load_formatted #ifndef GL_EXT_shader_image_load_formatted
#define GL_EXT_shader_image_load_formatted 1 #define GL_EXT_shader_image_load_formatted 1
#endif /* GL_EXT_shader_image_load_formatted */ #endif /* GL_EXT_shader_image_load_formatted */
@@ -8485,6 +8550,11 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F
#endif /* GL_EXT_texture_sRGB */ #endif /* GL_EXT_texture_sRGB */
#ifndef GL_EXT_texture_sRGB_R8
#define GL_EXT_texture_sRGB_R8 1
#define GL_SR8_EXT 0x8FBD
#endif /* GL_EXT_texture_sRGB_R8 */
#ifndef GL_EXT_texture_sRGB_decode #ifndef GL_EXT_texture_sRGB_decode
#define GL_EXT_texture_sRGB_decode 1 #define GL_EXT_texture_sRGB_decode 1
#define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 #define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48
@@ -8492,6 +8562,10 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode);
#define GL_SKIP_DECODE_EXT 0x8A4A #define GL_SKIP_DECODE_EXT 0x8A4A
#endif /* GL_EXT_texture_sRGB_decode */ #endif /* GL_EXT_texture_sRGB_decode */
#ifndef GL_EXT_texture_shadow_lod
#define GL_EXT_texture_shadow_lod 1
#endif /* GL_EXT_texture_shadow_lod */
#ifndef GL_EXT_texture_shared_exponent #ifndef GL_EXT_texture_shared_exponent
#define GL_EXT_texture_shared_exponent 1 #define GL_EXT_texture_shared_exponent 1
#define GL_RGB9_E5_EXT 0x8C3D #define GL_RGB9_E5_EXT 0x8C3D
@@ -9098,6 +9172,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG
#define GL_INTERLACE_READ_INGR 0x8568 #define GL_INTERLACE_READ_INGR 0x8568
#endif /* GL_INGR_interlace_read */ #endif /* GL_INGR_interlace_read */
#ifndef GL_INTEL_blackhole_render
#define GL_INTEL_blackhole_render 1
#define GL_BLACKHOLE_RENDER_INTEL 0x83FC
#endif /* GL_INTEL_blackhole_render */
#ifndef GL_INTEL_conservative_rasterization #ifndef GL_INTEL_conservative_rasterization
#define GL_INTEL_conservative_rasterization 1 #define GL_INTEL_conservative_rasterization 1
#define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE
@@ -9206,6 +9285,27 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen
#define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E #define GL_TEXTURE_2D_STACK_BINDING_MESAX 0x875E
#endif /* GL_MESAX_texture_stack */ #endif /* GL_MESAX_texture_stack */
#ifndef GL_MESA_framebuffer_flip_x
#define GL_MESA_framebuffer_flip_x 1
#define GL_FRAMEBUFFER_FLIP_X_MESA 0x8BBC
#endif /* GL_MESA_framebuffer_flip_x */
#ifndef GL_MESA_framebuffer_flip_y
#define GL_MESA_framebuffer_flip_y 1
#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB
typedef void (APIENTRYP PFNGLFRAMEBUFFERPARAMETERIMESAPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLGETFRAMEBUFFERPARAMETERIVMESAPROC) (GLenum target, GLenum pname, GLint *params);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFramebufferParameteriMESA (GLenum target, GLenum pname, GLint param);
GLAPI void APIENTRY glGetFramebufferParameterivMESA (GLenum target, GLenum pname, GLint *params);
#endif
#endif /* GL_MESA_framebuffer_flip_y */
#ifndef GL_MESA_framebuffer_swap_xy
#define GL_MESA_framebuffer_swap_xy 1
#define GL_FRAMEBUFFER_SWAP_XY_MESA 0x8BBD
#endif /* GL_MESA_framebuffer_swap_xy */
#ifndef GL_MESA_pack_invert #ifndef GL_MESA_pack_invert
#define GL_MESA_pack_invert 1 #define GL_MESA_pack_invert 1
#define GL_PACK_INVERT_MESA 0x8758 #define GL_PACK_INVERT_MESA 0x8758
@@ -9319,6 +9419,25 @@ GLAPI void APIENTRY glEndConditionalRenderNVX (void);
#define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B #define GL_GPU_MEMORY_INFO_EVICTED_MEMORY_NVX 0x904B
#endif /* GL_NVX_gpu_memory_info */ #endif /* GL_NVX_gpu_memory_info */
#ifndef GL_NVX_gpu_multicast2
#define GL_NVX_gpu_multicast2 1
#define GL_UPLOAD_GPU_MASK_NVX 0x954A
typedef void (APIENTRYP PFNGLUPLOADGPUMASKNVXPROC) (GLbitfield mask);
typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTICASTVIEWPORTPOSITIONWSCALENVXPROC) (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
typedef void (APIENTRYP PFNGLMULTICASTSCISSORARRAYVNVXPROC) (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
typedef GLuint (APIENTRYP PFNGLASYNCCOPYBUFFERSUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
typedef GLuint (APIENTRYP PFNGLASYNCCOPYIMAGESUBDATANVXPROC) (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glUploadGpuMaskNVX (GLbitfield mask);
GLAPI void APIENTRY glMulticastViewportArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLfloat *v);
GLAPI void APIENTRY glMulticastViewportPositionWScaleNVX (GLuint gpu, GLuint index, GLfloat xcoeff, GLfloat ycoeff);
GLAPI void APIENTRY glMulticastScissorArrayvNVX (GLuint gpu, GLuint first, GLsizei count, const GLint *v);
GLAPI GLuint APIENTRY glAsyncCopyBufferSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *fenceValueArray, GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
GLAPI GLuint APIENTRY glAsyncCopyImageSubDataNVX (GLsizei waitSemaphoreCount, const GLuint *waitSemaphoreArray, const GLuint64 *waitValueArray, GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth, GLsizei signalSemaphoreCount, const GLuint *signalSemaphoreArray, const GLuint64 *signalValueArray);
#endif
#endif /* GL_NVX_gpu_multicast2 */
#ifndef GL_NVX_linked_gpu_multicast #ifndef GL_NVX_linked_gpu_multicast
#define GL_NVX_linked_gpu_multicast 1 #define GL_NVX_linked_gpu_multicast 1
#define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800 #define GL_LGPU_SEPARATE_STORAGE_BIT_NVX 0x0800
@@ -9333,6 +9452,20 @@ GLAPI void APIENTRY glLGPUInterlockNVX (void);
#endif #endif
#endif /* GL_NVX_linked_gpu_multicast */ #endif /* GL_NVX_linked_gpu_multicast */
#ifndef GL_NVX_progress_fence
#define GL_NVX_progress_fence 1
typedef GLuint (APIENTRYP PFNGLCREATEPROGRESSFENCENVXPROC) (void);
typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREUI64NVXPROC) (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
typedef void (APIENTRYP PFNGLWAITSEMAPHOREUI64NVXPROC) (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
typedef void (APIENTRYP PFNGLCLIENTWAITSEMAPHOREUI64NVXPROC) (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLuint APIENTRY glCreateProgressFenceNVX (void);
GLAPI void APIENTRY glSignalSemaphoreui64NVX (GLuint signalGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
GLAPI void APIENTRY glWaitSemaphoreui64NVX (GLuint waitGpu, GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
GLAPI void APIENTRY glClientWaitSemaphoreui64NVX (GLsizei fenceObjectCount, const GLuint *semaphoreArray, const GLuint64 *fenceValueArray);
#endif
#endif /* GL_NVX_progress_fence */
#ifndef GL_NV_alpha_to_coverage_dither_control #ifndef GL_NV_alpha_to_coverage_dither_control
#define GL_NV_alpha_to_coverage_dither_control 1 #define GL_NV_alpha_to_coverage_dither_control 1
#define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D #define GL_ALPHA_TO_COVERAGE_DITHER_DEFAULT_NV 0x934D
@@ -9545,6 +9678,10 @@ GLAPI void APIENTRY glCallCommandListNV (GLuint list);
#define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC #define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC
#endif /* GL_NV_compute_program5 */ #endif /* GL_NV_compute_program5 */
#ifndef GL_NV_compute_shader_derivatives
#define GL_NV_compute_shader_derivatives 1
#endif /* GL_NV_compute_shader_derivatives */
#ifndef GL_NV_conditional_render #ifndef GL_NV_conditional_render
#define GL_NV_conditional_render 1 #define GL_NV_conditional_render 1
#define GL_QUERY_WAIT_NV 0x8E13 #define GL_QUERY_WAIT_NV 0x8E13
@@ -9843,6 +9980,10 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
#define GL_NV_fragment_program_option 1 #define GL_NV_fragment_program_option 1
#endif /* GL_NV_fragment_program_option */ #endif /* GL_NV_fragment_program_option */
#ifndef GL_NV_fragment_shader_barycentric
#define GL_NV_fragment_shader_barycentric 1
#endif /* GL_NV_fragment_shader_barycentric */
#ifndef GL_NV_fragment_shader_interlock #ifndef GL_NV_fragment_shader_interlock
#define GL_NV_fragment_shader_interlock 1 #define GL_NV_fragment_shader_interlock 1
#endif /* GL_NV_fragment_shader_interlock */ #endif /* GL_NV_fragment_shader_interlock */
@@ -9858,11 +9999,11 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons
#define GL_COVERAGE_MODULATION_NV 0x9332 #define GL_COVERAGE_MODULATION_NV 0x9332
#define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333 #define GL_COVERAGE_MODULATION_TABLE_SIZE_NV 0x9333
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v); typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONTABLENVPROC) (GLsizei n, const GLfloat *v);
typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufsize, GLfloat *v); typedef void (APIENTRYP PFNGLGETCOVERAGEMODULATIONTABLENVPROC) (GLsizei bufSize, GLfloat *v);
typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components); typedef void (APIENTRYP PFNGLCOVERAGEMODULATIONNVPROC) (GLenum components);
#ifdef GL_GLEXT_PROTOTYPES #ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v); GLAPI void APIENTRY glCoverageModulationTableNV (GLsizei n, const GLfloat *v);
GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufsize, GLfloat *v); GLAPI void APIENTRY glGetCoverageModulationTableNV (GLsizei bufSize, GLfloat *v);
GLAPI void APIENTRY glCoverageModulationNV (GLenum components); GLAPI void APIENTRY glCoverageModulationNV (GLenum components);
#endif #endif
#endif /* GL_NV_framebuffer_mixed_samples */ #endif /* GL_NV_framebuffer_mixed_samples */
@@ -10115,9 +10256,9 @@ GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint index, GLsizei n, const GLhalfN
#define GL_SUPERSAMPLE_SCALE_X_NV 0x9372 #define GL_SUPERSAMPLE_SCALE_X_NV 0x9372
#define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373 #define GL_SUPERSAMPLE_SCALE_Y_NV 0x9373
#define GL_CONFORMANT_NV 0x9374 #define GL_CONFORMANT_NV 0x9374
typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); typedef void (APIENTRYP PFNGLGETINTERNALFORMATSAMPLEIVNVPROC) (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
#ifdef GL_GLEXT_PROTOTYPES #ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei bufSize, GLint *params); GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum internalformat, GLsizei samples, GLenum pname, GLsizei count, GLint *params);
#endif #endif
#endif /* GL_NV_internalformat_sample_query */ #endif /* GL_NV_internalformat_sample_query */
@@ -10127,6 +10268,96 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna
#define GL_MAX_SPOT_EXPONENT_NV 0x8505 #define GL_MAX_SPOT_EXPONENT_NV 0x8505
#endif /* GL_NV_light_max_exponent */ #endif /* GL_NV_light_max_exponent */
#ifndef GL_NV_memory_attachment
#define GL_NV_memory_attachment 1
#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4
#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5
#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6
#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7
#define GL_MEMORY_ATTACHABLE_NV 0x95A8
#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9
#define GL_DETACHED_TEXTURES_NV 0x95AA
#define GL_DETACHED_BUFFERS_NV 0x95AB
#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC
#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD
typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname);
typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset);
typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params);
GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname);
GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset);
GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset);
#endif
#endif /* GL_NV_memory_attachment */
#ifndef GL_NV_mesh_shader
#define GL_NV_mesh_shader 1
#define GL_MESH_SHADER_NV 0x9559
#define GL_TASK_SHADER_NV 0x955A
#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60
#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61
#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62
#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63
#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64
#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65
#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66
#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67
#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68
#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69
#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A
#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B
#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C
#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D
#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E
#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F
#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2
#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3
#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536
#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537
#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538
#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539
#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A
#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D
#define GL_MAX_MESH_VIEWS_NV 0x9557
#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF
#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543
#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B
#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C
#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E
#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F
#define GL_MESH_VERTICES_OUT_NV 0x9579
#define GL_MESH_PRIMITIVES_OUT_NV 0x957A
#define GL_MESH_OUTPUT_TYPE_NV 0x957B
#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C
#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D
#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0
#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1
#define GL_MESH_SHADER_BIT_NV 0x00000040
#define GL_TASK_SHADER_BIT_NV 0x00000080
#define GL_MESH_SUBROUTINE_NV 0x957C
#define GL_TASK_SUBROUTINE_NV 0x957D
#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E
#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F
#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E
#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F
typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count);
typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect);
typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride);
typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count);
GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect);
GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride);
GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride);
#endif
#endif /* GL_NV_mesh_shader */
#ifndef GL_NV_multisample_coverage #ifndef GL_NV_multisample_coverage
#define GL_NV_multisample_coverage 1 #define GL_NV_multisample_coverage 1
#endif /* GL_NV_multisample_coverage */ #endif /* GL_NV_multisample_coverage */
@@ -10408,7 +10639,7 @@ typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXRANGENVPROC) (GLenum fontTarget, co
typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef GLenum (APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef GLenum (APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); typedef void (APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); typedef void (APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); typedef void (APIENTRYP PFNGLPATHCOLORGENNVPROC) (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); typedef void (APIENTRYP PFNGLPATHTEXGENNVPROC) (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode); typedef void (APIENTRYP PFNGLPATHFOGGENNVPROC) (GLenum genMode);
@@ -10473,7 +10704,7 @@ GLAPI GLenum APIENTRY glPathGlyphIndexRangeNV (GLenum fontTarget, const void *fo
GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GLAPI GLenum APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, const void *fontName, GLbitfield fontStyle, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GLAPI GLenum APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale);
GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); GLAPI void APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); GLAPI void APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei count, GLsizei *length, GLfloat *params);
GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs); GLAPI void APIENTRY glPathColorGenNV (GLenum color, GLenum genMode, GLenum colorFormat, const GLfloat *coeffs);
GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs); GLAPI void APIENTRY glPathTexGenNV (GLenum texCoordSet, GLenum genMode, GLint components, const GLfloat *coeffs);
GLAPI void APIENTRY glPathFogGenNV (GLenum genMode); GLAPI void APIENTRY glPathFogGenNV (GLenum genMode);
@@ -10562,9 +10793,9 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index);
#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545 #define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545
#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546 #define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546
#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547 #define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547
typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
#ifdef GL_GLEXT_PROTOTYPES #ifdef GL_GLEXT_PROTOTYPES
GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint count, GLint *buffer);
#endif #endif
#endif /* GL_NV_query_resource */ #endif /* GL_NV_query_resource */
@@ -10672,6 +10903,11 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname,
#endif #endif
#endif /* GL_NV_register_combiners2 */ #endif /* GL_NV_register_combiners2 */
#ifndef GL_NV_representative_fragment_test
#define GL_NV_representative_fragment_test 1
#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F
#endif /* GL_NV_representative_fragment_test */
#ifndef GL_NV_robustness_video_memory_purge #ifndef GL_NV_robustness_video_memory_purge
#define GL_NV_robustness_video_memory_purge 1 #define GL_NV_robustness_video_memory_purge 1
#define GL_PURGED_CONTEXT_RESET_NV 0x92BB #define GL_PURGED_CONTEXT_RESET_NV 0x92BB
@@ -10701,6 +10937,18 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void);
#define GL_NV_sample_mask_override_coverage 1 #define GL_NV_sample_mask_override_coverage 1
#endif /* GL_NV_sample_mask_override_coverage */ #endif /* GL_NV_sample_mask_override_coverage */
#ifndef GL_NV_scissor_exclusive
#define GL_NV_scissor_exclusive 1
#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555
#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556
typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height);
GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v);
#endif
#endif /* GL_NV_scissor_exclusive */
#ifndef GL_NV_shader_atomic_counters #ifndef GL_NV_shader_atomic_counters
#define GL_NV_shader_atomic_counters 1 #define GL_NV_shader_atomic_counters 1
#endif /* GL_NV_shader_atomic_counters */ #endif /* GL_NV_shader_atomic_counters */
@@ -10765,6 +11013,15 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
#define GL_NV_shader_storage_buffer_object 1 #define GL_NV_shader_storage_buffer_object 1
#endif /* GL_NV_shader_storage_buffer_object */ #endif /* GL_NV_shader_storage_buffer_object */
#ifndef GL_NV_shader_subgroup_partitioned
#define GL_NV_shader_subgroup_partitioned 1
#define GL_SUBGROUP_FEATURE_PARTITIONED_BIT_NV 0x00000100
#endif /* GL_NV_shader_subgroup_partitioned */
#ifndef GL_NV_shader_texture_footprint
#define GL_NV_shader_texture_footprint 1
#endif /* GL_NV_shader_texture_footprint */
#ifndef GL_NV_shader_thread_group #ifndef GL_NV_shader_thread_group
#define GL_NV_shader_thread_group 1 #define GL_NV_shader_thread_group 1
#define GL_WARP_SIZE_NV 0x9339 #define GL_WARP_SIZE_NV 0x9339
@@ -10776,6 +11033,47 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs
#define GL_NV_shader_thread_shuffle 1 #define GL_NV_shader_thread_shuffle 1
#endif /* GL_NV_shader_thread_shuffle */ #endif /* GL_NV_shader_thread_shuffle */
#ifndef GL_NV_shading_rate_image
#define GL_NV_shading_rate_image 1
#define GL_SHADING_RATE_IMAGE_NV 0x9563
#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564
#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565
#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566
#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567
#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568
#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569
#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A
#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B
#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C
#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D
#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E
#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F
#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B
#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C
#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D
#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E
#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F
#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE
#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF
#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0
typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture);
typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate);
typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location);
typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize);
typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order);
typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture);
GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate);
GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location);
GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize);
GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates);
GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order);
GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations);
#endif
#endif /* GL_NV_shading_rate_image */
#ifndef GL_NV_stereo_view_rendering #ifndef GL_NV_stereo_view_rendering
#define GL_NV_stereo_view_rendering 1 #define GL_NV_stereo_view_rendering 1
#endif /* GL_NV_stereo_view_rendering */ #endif /* GL_NV_stereo_view_rendering */
@@ -11068,7 +11366,7 @@ typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACENVPROC) (const
typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTEROUTPUTSURFACENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef GLboolean (APIENTRYP PFNGLVDPAUISSURFACENVPROC) (GLvdpauSurfaceNV surface);
typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface); typedef void (APIENTRYP PFNGLVDPAUUNREGISTERSURFACENVPROC) (GLvdpauSurfaceNV surface);
typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); typedef void (APIENTRYP PFNGLVDPAUGETSURFACEIVNVPROC) (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access); typedef void (APIENTRYP PFNGLVDPAUSURFACEACCESSNVPROC) (GLvdpauSurfaceNV surface, GLenum access);
typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); typedef void (APIENTRYP PFNGLVDPAUMAPSURFACESNVPROC) (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); typedef void (APIENTRYP PFNGLVDPAUUNMAPSURFACESNVPROC) (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
@@ -11079,13 +11377,21 @@ GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceNV (const void *vdpSu
GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames); GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterOutputSurfaceNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames);
GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface); GLAPI GLboolean APIENTRY glVDPAUIsSurfaceNV (GLvdpauSurfaceNV surface);
GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface); GLAPI void APIENTRY glVDPAUUnregisterSurfaceNV (GLvdpauSurfaceNV surface);
GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei bufSize, GLsizei *length, GLint *values); GLAPI void APIENTRY glVDPAUGetSurfaceivNV (GLvdpauSurfaceNV surface, GLenum pname, GLsizei count, GLsizei *length, GLint *values);
GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access); GLAPI void APIENTRY glVDPAUSurfaceAccessNV (GLvdpauSurfaceNV surface, GLenum access);
GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces); GLAPI void APIENTRY glVDPAUMapSurfacesNV (GLsizei numSurfaces, const GLvdpauSurfaceNV *surfaces);
GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces); GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSurfaceNV *surfaces);
#endif #endif
#endif /* GL_NV_vdpau_interop */ #endif /* GL_NV_vdpau_interop */
#ifndef GL_NV_vdpau_interop2
#define GL_NV_vdpau_interop2 1
typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure);
#endif
#endif /* GL_NV_vdpau_interop2 */
#ifndef GL_NV_vertex_array_range #ifndef GL_NV_vertex_array_range
#define GL_NV_vertex_array_range 1 #define GL_NV_vertex_array_range 1
#define GL_VERTEX_ARRAY_RANGE_NV 0x851D #define GL_VERTEX_ARRAY_RANGE_NV 0x851D
+290
View File
@@ -0,0 +1,290 @@
#ifndef __khrplatform_h_
#define __khrplatform_h_
/*
** Copyright (c) 2008-2018 The Khronos Group Inc.
**
** Permission is hereby granted, free of charge, to any person obtaining a
** copy of this software and/or associated documentation files (the
** "Materials"), to deal in the Materials without restriction, including
** without limitation the rights to use, copy, modify, merge, publish,
** distribute, sublicense, and/or sell copies of the Materials, and to
** permit persons to whom the Materials are furnished to do so, subject to
** the following conditions:
**
** The above copyright notice and this permission notice shall be included
** in all copies or substantial portions of the Materials.
**
** THE MATERIALS ARE PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND,
** EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF
** MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT.
** IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY
** CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT,
** TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE
** MATERIALS OR THE USE OR OTHER DEALINGS IN THE MATERIALS.
*/
/* Khronos platform-specific types and definitions.
*
* The master copy of khrplatform.h is maintained in the Khronos EGL
* Registry repository at https://github.com/KhronosGroup/EGL-Registry
* The last semantic modification to khrplatform.h was at commit ID:
* 67a3e0864c2d75ea5287b9f3d2eb74a745936692
*
* Adopters may modify this file to suit their platform. Adopters are
* encouraged to submit platform specific modifications to the Khronos
* group so that they can be included in future versions of this file.
* Please submit changes by filing pull requests or issues on
* the EGL Registry repository linked above.
*
*
* See the Implementer's Guidelines for information about where this file
* should be located on your system and for more details of its use:
* http://www.khronos.org/registry/implementers_guide.pdf
*
* This file should be included as
* #include <KHR/khrplatform.h>
* by Khronos client API header files that use its types and defines.
*
* The types in khrplatform.h should only be used to define API-specific types.
*
* Types defined in khrplatform.h:
* khronos_int8_t signed 8 bit
* khronos_uint8_t unsigned 8 bit
* khronos_int16_t signed 16 bit
* khronos_uint16_t unsigned 16 bit
* khronos_int32_t signed 32 bit
* khronos_uint32_t unsigned 32 bit
* khronos_int64_t signed 64 bit
* khronos_uint64_t unsigned 64 bit
* khronos_intptr_t signed same number of bits as a pointer
* khronos_uintptr_t unsigned same number of bits as a pointer
* khronos_ssize_t signed size
* khronos_usize_t unsigned size
* khronos_float_t signed 32 bit floating point
* khronos_time_ns_t unsigned 64 bit time in nanoseconds
* khronos_utime_nanoseconds_t unsigned time interval or absolute time in
* nanoseconds
* khronos_stime_nanoseconds_t signed time interval in nanoseconds
* khronos_boolean_enum_t enumerated boolean type. This should
* only be used as a base type when a client API's boolean type is
* an enum. Client APIs which use an integer or other type for
* booleans cannot use this as the base type for their boolean.
*
* Tokens defined in khrplatform.h:
*
* KHRONOS_FALSE, KHRONOS_TRUE Enumerated boolean false/true values.
*
* KHRONOS_SUPPORT_INT64 is 1 if 64 bit integers are supported; otherwise 0.
* KHRONOS_SUPPORT_FLOAT is 1 if floats are supported; otherwise 0.
*
* Calling convention macros defined in this file:
* KHRONOS_APICALL
* KHRONOS_APIENTRY
* KHRONOS_APIATTRIBUTES
*
* These may be used in function prototypes as:
*
* KHRONOS_APICALL void KHRONOS_APIENTRY funcname(
* int arg1,
* int arg2) KHRONOS_APIATTRIBUTES;
*/
#if defined(__SCITECH_SNAP__) && !defined(KHRONOS_STATIC)
# define KHRONOS_STATIC 1
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APICALL
*-------------------------------------------------------------------------
* This precedes the return type of the function in the function prototype.
*/
#if defined(KHRONOS_STATIC)
/* If the preprocessor constant KHRONOS_STATIC is defined, make the
* header compatible with static linking. */
# define KHRONOS_APICALL
#elif defined(_WIN32)
# define KHRONOS_APICALL __declspec(dllimport)
#elif defined (__SYMBIAN32__)
# define KHRONOS_APICALL IMPORT_C
#elif defined(__ANDROID__)
# define KHRONOS_APICALL __attribute__((visibility("default")))
#else
# define KHRONOS_APICALL
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APIENTRY
*-------------------------------------------------------------------------
* This follows the return type of the function and precedes the function
* name in the function prototype.
*/
#if defined(_WIN32) && !defined(_WIN32_WCE) && !defined(KHRONOS_STATIC)
/* Win32 but not WinCE */
# define KHRONOS_APIENTRY __stdcall
#else
# define KHRONOS_APIENTRY
#endif
/*-------------------------------------------------------------------------
* Definition of KHRONOS_APIATTRIBUTES
*-------------------------------------------------------------------------
* This follows the closing parenthesis of the function prototype arguments.
*/
#if defined (__ARMCC_2__)
#define KHRONOS_APIATTRIBUTES __softfp
#else
#define KHRONOS_APIATTRIBUTES
#endif
/*-------------------------------------------------------------------------
* basic type definitions
*-----------------------------------------------------------------------*/
#if (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L) || defined(__GNUC__) || defined(__SCO__) || defined(__USLC__)
/*
* Using <stdint.h>
*/
#include <stdint.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(__VMS ) || defined(__sgi)
/*
* Using <inttypes.h>
*/
#include <inttypes.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(_WIN32) && !defined(__SCITECH_SNAP__)
/*
* Win32
*/
typedef __int32 khronos_int32_t;
typedef unsigned __int32 khronos_uint32_t;
typedef __int64 khronos_int64_t;
typedef unsigned __int64 khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif defined(__sun__) || defined(__digital__)
/*
* Sun or Digital
*/
typedef int khronos_int32_t;
typedef unsigned int khronos_uint32_t;
#if defined(__arch64__) || defined(_LP64)
typedef long int khronos_int64_t;
typedef unsigned long int khronos_uint64_t;
#else
typedef long long int khronos_int64_t;
typedef unsigned long long int khronos_uint64_t;
#endif /* __arch64__ */
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#elif 0
/*
* Hypothetical platform with no float or int64 support
*/
typedef int khronos_int32_t;
typedef unsigned int khronos_uint32_t;
#define KHRONOS_SUPPORT_INT64 0
#define KHRONOS_SUPPORT_FLOAT 0
#else
/*
* Generic fallback
*/
#include <stdint.h>
typedef int32_t khronos_int32_t;
typedef uint32_t khronos_uint32_t;
typedef int64_t khronos_int64_t;
typedef uint64_t khronos_uint64_t;
#define KHRONOS_SUPPORT_INT64 1
#define KHRONOS_SUPPORT_FLOAT 1
#endif
/*
* Types that are (so far) the same on all platforms
*/
typedef signed char khronos_int8_t;
typedef unsigned char khronos_uint8_t;
typedef signed short int khronos_int16_t;
typedef unsigned short int khronos_uint16_t;
/*
* Types that differ between LLP64 and LP64 architectures - in LLP64,
* pointers are 64 bits, but 'long' is still 32 bits. Win64 appears
* to be the only LLP64 architecture in current use.
*/
#ifdef _WIN64
typedef signed long long int khronos_intptr_t;
typedef unsigned long long int khronos_uintptr_t;
typedef signed long long int khronos_ssize_t;
typedef unsigned long long int khronos_usize_t;
#else
typedef signed long int khronos_intptr_t;
typedef unsigned long int khronos_uintptr_t;
typedef signed long int khronos_ssize_t;
typedef unsigned long int khronos_usize_t;
#endif
#if KHRONOS_SUPPORT_FLOAT
/*
* Float type
*/
typedef float khronos_float_t;
#endif
#if KHRONOS_SUPPORT_INT64
/* Time types
*
* These types can be used to represent a time interval in nanoseconds or
* an absolute Unadjusted System Time. Unadjusted System Time is the number
* of nanoseconds since some arbitrary system event (e.g. since the last
* time the system booted). The Unadjusted System Time is an unsigned
* 64 bit value that wraps back to 0 every 584 years. Time intervals
* may be either signed or unsigned.
*/
typedef khronos_uint64_t khronos_utime_nanoseconds_t;
typedef khronos_int64_t khronos_stime_nanoseconds_t;
#endif
/*
* Dummy value used to pad enum types to 32 bits.
*/
#ifndef KHRONOS_MAX_ENUM
#define KHRONOS_MAX_ENUM 0x7FFFFFFF
#endif
/*
* Enumerated boolean type
*
* Values other than zero should be considered to be true. Therefore
* comparisons should not be made against KHRONOS_TRUE.
*/
typedef enum {
KHRONOS_FALSE = 0,
KHRONOS_TRUE = 1,
KHRONOS_BOOLEAN_ENUM_FORCE_SIZE = KHRONOS_MAX_ENUM
} khronos_boolean_enum_t;
#endif /* __khrplatform_h_ */
Vendored Submodule
+1
Submodule 3rdparty/flatbuffers added at 9e7e8cbe9f
+3
View File
@@ -27,6 +27,9 @@
<CharacterSet>MultiByte</CharacterSet> <CharacterSet>MultiByte</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets"> <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">
+3
View File
@@ -31,6 +31,9 @@
<CharacterSet>Unicode</CharacterSet> <CharacterSet>Unicode</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="PropertySheets"> <ImportGroup Label="PropertySheets">
+4 -1
View File
@@ -28,6 +28,9 @@
<CharacterSet>MultiByte</CharacterSet> <CharacterSet>MultiByte</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug Library|x64'" Label="PropertySheets"> <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug Library|x64'" Label="PropertySheets">
@@ -97,7 +100,7 @@
<DisableSpecificWarnings>$(DisableSpecificWarnings)</DisableSpecificWarnings> <DisableSpecificWarnings>$(DisableSpecificWarnings)</DisableSpecificWarnings>
<AdditionalIncludeDirectories>$(ZLibSrcDir);%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories> <AdditionalIncludeDirectories>$(ZLibSrcDir);%(AdditionalIncludeDirectories)</AdditionalIncludeDirectories>
<TreatWarningAsError>$(TreatWarningAsError)</TreatWarningAsError> <TreatWarningAsError>$(TreatWarningAsError)</TreatWarningAsError>
<Optimization>Full</Optimization> <Optimization>MaxSpeed</Optimization>
<WholeProgramOptimization>true</WholeProgramOptimization> <WholeProgramOptimization>true</WholeProgramOptimization>
</ClCompile> </ClCompile>
<Link> <Link>
+3
View File
@@ -24,6 +24,9 @@
<WholeProgramOptimization Condition="'$(Configuration)'=='Release'">true</WholeProgramOptimization> <WholeProgramOptimization Condition="'$(Configuration)'=='Release'">true</WholeProgramOptimization>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="PropertySheets"> <ImportGroup Label="PropertySheets">
+3
View File
@@ -21,6 +21,9 @@
</PropertyGroup> </PropertyGroup>
<Import Project="$(SolutionDir)\3rdparty\zlib.props" /> <Import Project="$(SolutionDir)\3rdparty\zlib.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'"> <ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
+3
View File
@@ -28,6 +28,9 @@
<CharacterSet>Unicode</CharacterSet> <CharacterSet>Unicode</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets"> <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="PropertySheets">
+7 -1
View File
@@ -27,6 +27,9 @@
<UseDebugLibraries>false</UseDebugLibraries> <UseDebugLibraries>false</UseDebugLibraries>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="PropertySheets"> <ImportGroup Label="PropertySheets">
@@ -41,7 +44,10 @@
</ImportGroup> </ImportGroup>
<PropertyGroup Label="UserMacros" /> <PropertyGroup Label="UserMacros" />
<PropertyGroup /> <PropertyGroup />
<ItemDefinitionGroup> <ItemDefinitionGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<ClCompile>
<Optimization>MaxSpeed</Optimization>
</ClCompile>
</ItemDefinitionGroup> </ItemDefinitionGroup>
<ItemGroup> <ItemGroup>
<ClCompile Include="xxHash/xxhash.c" /> <ClCompile Include="xxHash/xxhash.c" />
+4
View File
@@ -22,6 +22,9 @@
<CharacterSet>Unicode</CharacterSet> <CharacterSet>Unicode</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="Shared"> <ImportGroup Label="Shared">
@@ -40,6 +43,7 @@
<ItemDefinitionGroup> <ItemDefinitionGroup>
<ClCompile> <ClCompile>
<ExceptionHandling>Sync</ExceptionHandling> <ExceptionHandling>Sync</ExceptionHandling>
<Optimization Condition="'$(Configuration)|$(Platform)'=='Release|x64'">MaxSpeed</Optimization>
</ClCompile> </ClCompile>
</ItemDefinitionGroup> </ItemDefinitionGroup>
<ItemGroup> <ItemGroup>
+4 -1
View File
@@ -31,6 +31,9 @@
<Import Project="$(SolutionDir)\3rdparty\zlib.props" /> <Import Project="$(SolutionDir)\3rdparty\zlib.props" />
<Import Project="..\common_default.props" /> <Import Project="..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<Import Project="..\common_default_macros.props" /> <Import Project="..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
<ConfigurationType>StaticLibrary</ConfigurationType> <ConfigurationType>StaticLibrary</ConfigurationType>
@@ -79,7 +82,7 @@
<ClCompile> <ClCompile>
<WarningLevel>$(WarningLevel)</WarningLevel> <WarningLevel>$(WarningLevel)</WarningLevel>
<DebugInformationFormat>ProgramDatabase</DebugInformationFormat> <DebugInformationFormat>ProgramDatabase</DebugInformationFormat>
<Optimization>Full</Optimization> <Optimization>MaxSpeed</Optimization>
<IntrinsicFunctions>true</IntrinsicFunctions> <IntrinsicFunctions>true</IntrinsicFunctions>
<WholeProgramOptimization>true</WholeProgramOptimization> <WholeProgramOptimization>true</WholeProgramOptimization>
<BufferSecurityCheck>false</BufferSecurityCheck> <BufferSecurityCheck>false</BufferSecurityCheck>
+5 -5
View File
@@ -9,11 +9,11 @@ Other instructions may be found [here](https://wiki.rpcs3.net/index.php?title=Bu
* [CMake 3.14.1+](https://www.cmake.org/download/) (add to PATH) * [CMake 3.14.1+](https://www.cmake.org/download/) (add to PATH)
* [Python 3.3+](https://www.python.org/downloads/) (add to PATH) * [Python 3.3+](https://www.python.org/downloads/) (add to PATH)
* [Qt 5.14+](https://www.qt.io/download-qt-installer) * [Qt 5.14.2](https://www.qt.io/download-qt-installer)
* [Visual Studio 2019](https://visualstudio.microsoft.com/thank-you-downloading-visual-studio/?sku=Community) * [Visual Studio 2019](https://visualstudio.microsoft.com/thank-you-downloading-visual-studio/?sku=Community)
* [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/windows/getting_started.html)) * [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/windows/getting_started.html))
**Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.14.1\msvc2017_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools-19123)** **Either add the** `QTDIR` **environment variable, e.g.** `<QtInstallFolder>\5.14.2\msvc2017_64\` **, or use the [Visual Studio Qt Plugin](https://marketplace.visualstudio.com/items?itemName=TheQtCompany.QtVisualStudioTools-19123)**
### Linux ### Linux
@@ -21,7 +21,7 @@ These are the essentials tools to build RPCS3 on Linux. Some of them can be inst
* Clang 9+ or GCC 9+ * Clang 9+ or GCC 9+
* [CMake 3.14.1+](https://www.cmake.org/download/) * [CMake 3.14.1+](https://www.cmake.org/download/)
* [Qt 5.14+](https://www.qt.io/download-qt-installer) * [Qt 5.14.2](https://www.qt.io/download-qt-installer)
* [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/linux/getting_started.html)) * [Vulkan SDK 1.1.126+](https://vulkan.lunarg.com/sdk/home) (See "Install the SDK" [here](https://vulkan.lunarg.com/doc/sdk/latest/linux/getting_started.html))
* [SDL2](https://www.libsdl.org/download-2.0.php) (for the FAudio backend) * [SDL2](https://www.libsdl.org/download-2.0.php) (for the FAudio backend)
@@ -41,7 +41,7 @@ Ubuntu is usually horrendously out of date, and some packages need to be downloa
Ubuntu usually does not have a new enough Qt package to suit rpcs3's needs. There is a PPA available to work around this. Run the following: Ubuntu usually does not have a new enough Qt package to suit rpcs3's needs. There is a PPA available to work around this. Run the following:
``` ```
ucodename=$(lsb_release -sc) ucodename=$(lsb_release -sc)
sudo add-apt-repository ppa:beineri/opt-qt-5.14.1-$ucodename sudo add-apt-repository ppa:beineri/opt-qt-5.14.2-$ucodename
sudo apt-get update sudo apt-get update
. /opt/qt514/bin/qt514-env.sh >/dev/null 2>&1 . /opt/qt514/bin/qt514-env.sh >/dev/null 2>&1
sudo apt-get install qt514-meta-minimal qt514svg sudo apt-get install qt514-meta-minimal qt514svg
@@ -103,7 +103,7 @@ git submodule update --init
#### Configuring the Qt plugin (if used) #### Configuring the Qt plugin (if used)
1) Go to the Qt5 menu and edit Qt5 options. 1) Go to the Qt5 menu and edit Qt5 options.
2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.14.1\msvc2017_64`. 2) Add the path to your Qt installation with compiler e.g. `<QtInstallFolder>\5.14.2\msvc2017_64`.
3) While selecting the rpcs3qt project, go to Qt5->Project Setting and select the version you added. 3) While selecting the rpcs3qt project, go to Qt5->Project Setting and select the version you added.
#### Building the projects #### Building the projects
+4 -2
View File
@@ -1,8 +1,10 @@
RPCS3 RPCS3
===== =====
[![Build Status](https://travis-ci.org/RPCS3/rpcs3.svg?branch=master)](https://travis-ci.org/RPCS3/rpcs3) [![Travis (.org) branch](https://img.shields.io/travis/RPCS3/rpcs3/master?label=Travis%20CI&logo=travis)](https://travis-ci.org/RPCS3/rpcs3)
[![Build Status](https://dev.azure.com/nekotekina/nekotekina/_apis/build/status/RPCS3.rpcs3?branchName=master)](https://dev.azure.com/nekotekina/nekotekina/_build/latest?definitionId=4&branchName=master) [![Azure Build Status](https://dev.azure.com/nekotekina/nekotekina/_apis/build/status/RPCS3.rpcs3?branchName=master)](https://dev.azure.com/nekotekina/nekotekina/_build?definitionId=4&branchName=master)
[![Cirrus CI - Base Branch Build Status](https://img.shields.io/cirrus/github/RPCS3/rpcs3?label=Cirrus%20CI%20(FreeBSD)&logo=cirrus-ci)](https://cirrus-ci.com/github/RPCS3/rpcs3)
[![RPCS3 discord server](https://img.shields.io/discord/272035812277878785?color=%237289DA&label=RPCS3%20Discord&logo=discord&logoColor=white)](https://discord.me/rpcs3)
The world's first free and open-source PlayStation 3 emulator/debugger, written in C++ for Windows and Linux. The world's first free and open-source PlayStation 3 emulator/debugger, written in C++ for Windows and Linux.
+51 -7
View File
@@ -1,8 +1,10 @@
#pragma once #ifndef BETYPE_H_GUARD
#define BETYPE_H_GUARD
#include "types.h" #include "types.h"
#include "util/endian.hpp" #include "util/endian.hpp"
#include <cstring> #include <cstring>
#include <cmath>
#if __has_include(<bit>) #if __has_include(<bit>)
#include <bit> #include <bit>
@@ -13,7 +15,8 @@
// 128-bit vector type and also se_storage<> storage type // 128-bit vector type and also se_storage<> storage type
union alignas(16) v128 union alignas(16) v128
{ {
char _bytes[16]; uchar _bytes[16];
char _chars[16];
template <typename T, std::size_t N, std::size_t M> template <typename T, std::size_t N, std::size_t M>
struct masked_array_t // array type accessed as (index ^ M) struct masked_array_t // array type accessed as (index ^ M)
@@ -312,14 +315,54 @@ union alignas(16) v128
return fromV(_mm_cmpeq_epi32(left.vi, right.vi)); return fromV(_mm_cmpeq_epi32(left.vi, right.vi));
} }
static inline v128 eq32f(const v128& left, const v128& right)
{
return fromF(_mm_cmpeq_ps(left.vf, right.vf));
}
static inline v128 eq64f(const v128& left, const v128& right)
{
return fromD(_mm_cmpeq_pd(left.vd, right.vd));
}
static inline bool use_fma = false;
static inline v128 fma32f(v128 a, const v128& b, const v128& c)
{
#ifndef __FMA__
if (use_fma) [[likely]]
{
#ifdef _MSC_VER
a.vf = _mm_fmadd_ps(a.vf, b.vf, c.vf);
return a;
#else
__asm__("vfmadd213ps %[c], %[b], %[a]"
: [a] "+x" (a.vf)
: [b] "x" (b.vf)
, [c] "x" (c.vf));
return a;
#endif
}
for (int i = 0; i < 4; i++)
{
a._f[i] = std::fmaf(a._f[i], b._f[i], c._f[i]);
}
return a;
#else
a.vf = _mm_fmadd_ps(a.vf, b.vf, c.vf);
return a;
#endif
}
bool operator==(const v128& right) const bool operator==(const v128& right) const
{ {
return _u64[0] == right._u64[0] && _u64[1] == right._u64[1]; return _mm_movemask_epi8(v128::eq32(*this, right).vi) == 0xffff;
} }
bool operator!=(const v128& right) const bool operator!=(const v128& right) const
{ {
return _u64[0] != right._u64[0] || _u64[1] != right._u64[1]; return !operator==(right);
} }
// result = (~left) & (right) // result = (~left) & (right)
@@ -330,8 +373,7 @@ union alignas(16) v128
void clear() void clear()
{ {
_u64[0] = 0; *this = {};
_u64[1] = 0;
} }
}; };
@@ -362,7 +404,7 @@ inline v128 operator^(const v128& left, const v128& right)
inline v128 operator~(const v128& other) inline v128 operator~(const v128& other)
{ {
return v128::from64(~other._u64[0], ~other._u64[1]); return other ^ v128::from32p(UINT32_MAX); // XOR with ones
} }
using stx::se_t; using stx::se_t;
@@ -465,3 +507,5 @@ struct fmt_unveil<se_t<T, Se, Align>, void>
return fmt_unveil<T>::get(arg); return fmt_unveil<T>::get(arg);
} }
}; };
#endif // BETYPE_H_GUARD
+10 -1
View File
@@ -65,6 +65,13 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
const char* start = &value.front(); const char* start = &value.front();
const char* end = &value.back() + 1; const char* end = &value.back() + 1;
int base = 10; int base = 10;
int sign = +1;
if (start[0] == '-')
{
sign = -1;
start += 1;
}
if (start[0] == '0' && (start[1] == 'x' || start[1] == 'X')) if (start[0] == '0' && (start[1] == 'x' || start[1] == 'X'))
{ {
@@ -75,12 +82,14 @@ bool cfg::try_to_int64(s64* out, const std::string& value, s64 min, s64 max)
const auto ret = std::from_chars(start, end, result, base); const auto ret = std::from_chars(start, end, result, base);
if (ret.ec != std::errc() || ret.ptr != end) if (ret.ec != std::errc() || ret.ptr != end || (start[0] == '-' && sign < 0))
{ {
if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value); if (out) cfg_log.error("cfg::try_to_int('%s'): invalid integer", value);
return false; return false;
} }
result *= sign;
if (result < min || result > max) if (result < min || result > max)
{ {
if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%d..%d)", value, min, max); if (out) cfg_log.error("cfg::try_to_int('%s'): out of bounds (%d..%d)", value, min, max);
+1 -1
View File
@@ -384,7 +384,7 @@ namespace cfg
using uint64 = uint<0, UINT64_MAX>; using uint64 = uint<0, UINT64_MAX>;
// Simple string entry with mutex // Simple string entry with mutex
class string final : public _base class string : public _base
{ {
const std::string m_name; const std::string m_name;
+3
View File
@@ -129,6 +129,7 @@ static fs::error to_error(DWORD e)
case ERROR_DIR_NOT_EMPTY: return fs::error::notempty; case ERROR_DIR_NOT_EMPTY: return fs::error::notempty;
case ERROR_NOT_READY: return fs::error::noent; case ERROR_NOT_READY: return fs::error::noent;
case ERROR_FILENAME_EXCED_RANGE: return fs::error::toolong; case ERROR_FILENAME_EXCED_RANGE: return fs::error::toolong;
case ERROR_DISK_FULL: return fs::error::nospace;
default: return fs::error::unknown; default: return fs::error::unknown;
} }
} }
@@ -170,6 +171,7 @@ static fs::error to_error(int e)
case ENOTEMPTY: return fs::error::notempty; case ENOTEMPTY: return fs::error::notempty;
case EROFS: return fs::error::readonly; case EROFS: return fs::error::readonly;
case EISDIR: return fs::error::isdir; case EISDIR: return fs::error::isdir;
case ENOSPC: return fs::error::nospace;
default: return fs::error::unknown; default: return fs::error::unknown;
} }
} }
@@ -1818,6 +1820,7 @@ void fmt_class_string<fs::error>::format(std::string& out, u64 arg)
case fs::error::readonly: return "Read only"; case fs::error::readonly: return "Read only";
case fs::error::isdir: return "Is a directory"; case fs::error::isdir: return "Is a directory";
case fs::error::toolong: return "Path too long"; case fs::error::toolong: return "Path too long";
case fs::error::nospace: return "Not enough space on the device";
case fs::error::unknown: return "Unknown system error"; case fs::error::unknown: return "Unknown system error";
} }
+1
View File
@@ -516,6 +516,7 @@ namespace fs
readonly, readonly,
isdir, isdir,
toolong, toolong,
nospace,
unknown unknown
}; };
+13 -13
View File
@@ -915,10 +915,10 @@ public:
~ObjectCache() override = default; ~ObjectCache() override = default;
void notifyObjectCompiled(const llvm::Module* module, llvm::MemoryBufferRef obj) override void notifyObjectCompiled(const llvm::Module* _module, llvm::MemoryBufferRef obj) override
{ {
std::string name = m_path; std::string name = m_path;
name.append(module->getName().data()); name.append(_module->getName().data());
//fs::file(name, fs::rewrite).write(obj.getBufferStart(), obj.getBufferSize()); //fs::file(name, fs::rewrite).write(obj.getBufferStart(), obj.getBufferSize());
name.append(".gz"); name.append(".gz");
@@ -948,14 +948,14 @@ public:
} }
default: default:
{ {
jit_log.error("LLVM: Failed to compress module: %s", module->getName().data()); jit_log.error("LLVM: Failed to compress module: %s", _module->getName().data());
deflateEnd(&zs); deflateEnd(&zs);
return; return;
} }
} }
fs::file(name, fs::rewrite).write(zbuf.get(), zsz - zs.avail_out); fs::file(name, fs::rewrite).write(zbuf.get(), zsz - zs.avail_out);
jit_log.notice("LLVM: Created module: %s", module->getName().data()); jit_log.notice("LLVM: Created module: %s", _module->getName().data());
} }
static std::unique_ptr<llvm::MemoryBuffer> load(const std::string& path) static std::unique_ptr<llvm::MemoryBuffer> load(const std::string& path)
@@ -1033,14 +1033,14 @@ public:
return nullptr; return nullptr;
} }
std::unique_ptr<llvm::MemoryBuffer> getObject(const llvm::Module* module) override std::unique_ptr<llvm::MemoryBuffer> getObject(const llvm::Module* _module) override
{ {
std::string path = m_path; std::string path = m_path;
path.append(module->getName().data()); path.append(_module->getName().data());
if (auto buf = load(path)) if (auto buf = load(path))
{ {
jit_log.notice("LLVM: Loaded module: %s", module->getName().data()); jit_log.notice("LLVM: Loaded module: %s", _module->getName().data());
return buf; return buf;
} }
@@ -1166,13 +1166,13 @@ jit_compiler::~jit_compiler()
{ {
} }
void jit_compiler::add(std::unique_ptr<llvm::Module> module, const std::string& path) void jit_compiler::add(std::unique_ptr<llvm::Module> _module, const std::string& path)
{ {
ObjectCache cache{path}; ObjectCache cache{path};
m_engine->setObjectCache(&cache); m_engine->setObjectCache(&cache);
const auto ptr = module.get(); const auto ptr = _module.get();
m_engine->addModule(std::move(module)); m_engine->addModule(std::move(_module));
m_engine->generateCodeForModule(ptr); m_engine->generateCodeForModule(ptr);
m_engine->setObjectCache(nullptr); m_engine->setObjectCache(nullptr);
@@ -1183,10 +1183,10 @@ void jit_compiler::add(std::unique_ptr<llvm::Module> module, const std::string&
} }
} }
void jit_compiler::add(std::unique_ptr<llvm::Module> module) void jit_compiler::add(std::unique_ptr<llvm::Module> _module)
{ {
const auto ptr = module.get(); const auto ptr = _module.get();
m_engine->addModule(std::move(module)); m_engine->addModule(std::move(_module));
m_engine->generateCodeForModule(ptr); m_engine->generateCodeForModule(ptr);
for (auto& func : ptr->functions()) for (auto& func : ptr->functions())
+2 -2
View File
@@ -163,10 +163,10 @@ public:
} }
// Add module (path to obj cache dir) // Add module (path to obj cache dir)
void add(std::unique_ptr<llvm::Module> module, const std::string& path); void add(std::unique_ptr<llvm::Module> _module, const std::string& path);
// Add module (not cached) // Add module (not cached)
void add(std::unique_ptr<llvm::Module> module); void add(std::unique_ptr<llvm::Module> _module);
// Add object (path to obj file) // Add object (path to obj file)
void add(const std::string& path); void add(const std::string& path);
+54 -33
View File
@@ -1382,6 +1382,7 @@ bool handle_access_violation(u32 addr, bool is_writing, x64_context* context) no
if (cpu) if (cpu)
{ {
vm::temporary_unlock(*cpu);
u32 pf_port_id = 0; u32 pf_port_id = 0;
if (auto pf_entries = g_fxo->get<page_fault_notification_entries>(); true) if (auto pf_entries = g_fxo->get<page_fault_notification_entries>(); true)
@@ -1416,7 +1417,7 @@ bool handle_access_violation(u32 addr, bool is_writing, x64_context* context) no
{ {
const auto& spu = static_cast<spu_thread&>(*cpu); const auto& spu = static_cast<spu_thread&>(*cpu);
const u64 type = spu.offset < RAW_SPU_BASE_ADDR ? const u64 type = spu.get_type() == spu_type::threaded ?
SYS_MEMORY_PAGE_FAULT_TYPE_SPU_THREAD : SYS_MEMORY_PAGE_FAULT_TYPE_SPU_THREAD :
SYS_MEMORY_PAGE_FAULT_TYPE_RAW_SPU; SYS_MEMORY_PAGE_FAULT_TYPE_RAW_SPU;
@@ -1441,13 +1442,19 @@ bool handle_access_violation(u32 addr, bool is_writing, x64_context* context) no
} }
} }
// Deschedule
if (cpu->id_type() == 1)
{
lv2_obj::sleep(*cpu);
}
// Now, place the page fault event onto table so that other functions [sys_mmapper_free_address and pagefault recovery funcs etc] // Now, place the page fault event onto table so that other functions [sys_mmapper_free_address and pagefault recovery funcs etc]
// know that this thread is page faulted and where. // know that this thread is page faulted and where.
auto pf_events = g_fxo->get<page_fault_event_entries>(); auto pf_events = g_fxo->get<page_fault_event_entries>();
{ {
std::lock_guard pf_lock(pf_events->pf_mutex); std::lock_guard pf_lock(pf_events->pf_mutex);
pf_events->events.emplace(static_cast<u32>(data2), addr); pf_events->events.emplace(cpu, addr);
} }
sig_log.warning("Page_fault %s location 0x%x because of %s memory", is_writing ? "writing" : "reading", sig_log.warning("Page_fault %s location 0x%x because of %s memory", is_writing ? "writing" : "reading",
@@ -1466,38 +1473,32 @@ bool handle_access_violation(u32 addr, bool is_writing, x64_context* context) no
// If we fail due to being busy, wait a bit and try again. // If we fail due to being busy, wait a bit and try again.
while (static_cast<u32>(sending_error) == CELL_EBUSY) while (static_cast<u32>(sending_error) == CELL_EBUSY)
{ {
if (cpu->id_type() == 1) if (cpu->is_stopped())
{ {
lv2_obj::sleep(*cpu, 1000); sending_error = {};
break;
} }
thread_ctrl::wait_for(1000); thread_ctrl::wait_for(1000);
sending_error = sys_event_port_send(pf_port_id, data1, data2, data3); sending_error = sys_event_port_send(pf_port_id, data1, data2, data3);
} }
if (cpu->id_type() == 1)
{
// Deschedule
lv2_obj::sleep(*cpu);
}
if (sending_error) if (sending_error)
{ {
vm_log.fatal("Unknown error %x while trying to pass page fault.", +sending_error); vm_log.fatal("Unknown error 0x%x while trying to pass page fault.", +sending_error);
cpu->state += cpu_flag::dbg_pause;
} }
else
// Wait until the thread is recovered
for (std::shared_lock pf_lock(pf_events->pf_mutex);
pf_events->events.count(static_cast<u32>(data2)) && !sending_error;)
{ {
if (cpu->is_stopped()) // Wait until the thread is recovered
while (!cpu->state.test_and_reset(cpu_flag::signal))
{ {
break; if (cpu->is_stopped())
} {
break;
}
// Timeout in case the emulator is stopping thread_ctrl::wait();
pf_events->cond.wait(pf_lock, 10000); }
} }
// Reschedule, test cpu state and try recovery if stopped // Reschedule, test cpu state and try recovery if stopped
@@ -1657,10 +1658,10 @@ static LONG exception_filter(PEXCEPTION_POINTERS pExp) noexcept
//const auto uw = (u8*)(unwind_base + rtf->UnwindData); //const auto uw = (u8*)(unwind_base + rtf->UnwindData);
} }
for (HMODULE module : modules) for (HMODULE _module : modules)
{ {
MODULEINFO info; MODULEINFO info;
if (GetModuleInformation(GetCurrentProcess(), module, &info, sizeof(info))) if (GetModuleInformation(GetCurrentProcess(), _module, &info, sizeof(info)))
{ {
const DWORD64 base = reinterpret_cast<DWORD64>(info.lpBaseOfDll); const DWORD64 base = reinterpret_cast<DWORD64>(info.lpBaseOfDll);
@@ -1670,7 +1671,7 @@ static LONG exception_filter(PEXCEPTION_POINTERS pExp) noexcept
for (DWORD size = 15; module_name.size() != size;) for (DWORD size = 15; module_name.size() != size;)
{ {
module_name.resize(size); module_name.resize(size);
size = GetModuleBaseNameA(GetCurrentProcess(), module, &module_name.front(), size + 1); size = GetModuleBaseNameA(GetCurrentProcess(), _module, &module_name.front(), size + 1);
if (!size) if (!size)
{ {
module_name.clear(); module_name.clear();
@@ -1891,6 +1892,7 @@ void thread_base::initialize(void (*error_cb)(), bool(*wait_cb)(const void*))
void thread_base::notify_abort() noexcept void thread_base::notify_abort() noexcept
{ {
m_signal.try_inc();
atomic_storage_futex::raw_notify(+m_state_notifier); atomic_storage_futex::raw_notify(+m_state_notifier);
} }
@@ -2154,7 +2156,7 @@ void thread_ctrl::detect_cpu_layout()
if (!g_native_core_layout.compare_and_swap_test(native_core_arrangement::undefined, native_core_arrangement::generic)) if (!g_native_core_layout.compare_and_swap_test(native_core_arrangement::undefined, native_core_arrangement::generic))
return; return;
const auto system_id = utils::get_system_info(); const auto system_id = utils::get_cpu_brand();
if (system_id.find("Ryzen") != umax) if (system_id.find("Ryzen") != umax)
{ {
g_native_core_layout.store(native_core_arrangement::amd_ccx); g_native_core_layout.store(native_core_arrangement::amd_ccx);
@@ -2226,7 +2228,7 @@ u64 thread_ctrl::get_affinity_mask(thread_class group)
case native_core_arrangement::amd_ccx: case native_core_arrangement::amd_ccx:
{ {
u64 spu_mask, ppu_mask, rsx_mask; u64 spu_mask, ppu_mask, rsx_mask;
const auto system_id = utils::get_system_info(); const auto system_id = utils::get_cpu_brand();
if (thread_count >= 32) if (thread_count >= 32)
{ {
if (system_id.find("3950X") != umax) if (system_id.find("3950X") != umax)
@@ -2399,6 +2401,30 @@ void thread_ctrl::set_native_priority(int priority)
#endif #endif
} }
u64 thread_ctrl::get_process_affinity_mask()
{
static const u64 mask = []() -> u64
{
#ifdef _WIN32
DWORD_PTR res, _sys;
if (!GetProcessAffinityMask(GetCurrentProcess(), &res, &_sys))
{
sig_log.error("Failed to get process affinity mask.");
return 0;
}
return res;
#else
// Assume it's called from the main thread (this is a bit shaky)
return thread_ctrl::get_thread_affinity_mask();
#endif
}();
return mask;
}
DECLARE(thread_ctrl::process_affinity_mask) = get_process_affinity_mask();
void thread_ctrl::set_thread_affinity_mask(u64 mask) void thread_ctrl::set_thread_affinity_mask(u64 mask)
{ {
#ifdef _WIN32 #ifdef _WIN32
@@ -2441,12 +2467,7 @@ void thread_ctrl::set_thread_affinity_mask(u64 mask)
u64 thread_ctrl::get_thread_affinity_mask() u64 thread_ctrl::get_thread_affinity_mask()
{ {
#ifdef _WIN32 #ifdef _WIN32
DWORD_PTR res, _sys; const u64 res = get_process_affinity_mask();
if (!GetProcessAffinityMask(GetCurrentProcess(), &res, &_sys))
{
sig_log.error("Failed to get process affinity mask.");
return 0;
}
if (DWORD_PTR result = SetThreadAffinityMask(GetCurrentThread(), res)) if (DWORD_PTR result = SetThreadAffinityMask(GetCurrentThread(), res))
{ {
@@ -2470,7 +2491,7 @@ u64 thread_ctrl::get_thread_affinity_mask()
return 0; return 0;
} }
u64 result; u64 result = 0;
for (u32 core = 0; core < 64u; core++) for (u32 core = 0; core < 64u; core++)
{ {
+13
View File
@@ -210,6 +210,12 @@ public:
static_cast<thread_base&>(thread).notify(); static_cast<thread_base&>(thread).notify();
} }
template <typename T>
static void raw_notify(named_thread<T>& thread)
{
static_cast<thread_base&>(thread).notify_abort();
}
// Read current state // Read current state
static inline thread_state state() static inline thread_state state()
{ {
@@ -249,8 +255,15 @@ public:
// Sets the preferred affinity mask for this thread // Sets the preferred affinity mask for this thread
static void set_thread_affinity_mask(u64 mask); static void set_thread_affinity_mask(u64 mask);
// Get process affinity mask
static u64 get_process_affinity_mask();
// Miscellaneous // Miscellaneous
static u64 get_thread_affinity_mask(); static u64 get_thread_affinity_mask();
private:
// Miscellaneous
static const u64 process_affinity_mask;
}; };
// Derived from the callable object Context, possibly a lambda // Derived from the callable object Context, possibly a lambda
+25
View File
@@ -63,6 +63,17 @@ namespace utils
#ifdef _WIN32 #ifdef _WIN32
return ::VirtualAlloc(use_addr, size, MEM_RESERVE, PAGE_NOACCESS); return ::VirtualAlloc(use_addr, size, MEM_RESERVE, PAGE_NOACCESS);
#else #else
if (use_addr && reinterpret_cast<uptr>(use_addr) % 0x10000)
{
return nullptr;
}
if (!use_addr)
{
// Hack: Ensure aligned 64k allocations
size += 0x10000;
}
auto ptr = ::mmap(use_addr, size, PROT_NONE, MAP_ANON | MAP_PRIVATE, -1, 0); auto ptr = ::mmap(use_addr, size, PROT_NONE, MAP_ANON | MAP_PRIVATE, -1, 0);
if (ptr == reinterpret_cast<void*>(-1)) if (ptr == reinterpret_cast<void*>(-1))
@@ -76,6 +87,20 @@ namespace utils
return nullptr; return nullptr;
} }
if (!use_addr && ptr)
{
// Continuation of the hack above
const auto misalign = reinterpret_cast<uptr>(ptr) % 0x10000;
::munmap(ptr, 0x10000 - misalign);
if (misalign)
{
::munmap(static_cast<u8*>(ptr) + size - misalign, misalign);
}
ptr = static_cast<u8*>(ptr) + (0x10000 - misalign);
}
return ptr; return ptr;
#endif #endif
} }
+1116 -193
View File
File diff suppressed because it is too large Load Diff
+121 -12
View File
@@ -1,12 +1,30 @@
#pragma once #pragma once
#include "BEType.h" #include "BEType.h"
#include <vector> #include <vector>
#include <string> #include <string>
#include <unordered_map> #include <unordered_map>
#include "util/yaml.hpp"
namespace patch_key
{
static const std::string all = "All";
static const std::string anchors = "Anchors";
static const std::string author = "Author";
static const std::string games = "Games";
static const std::string group = "Group";
static const std::string notes = "Notes";
static const std::string patch = "Patch";
static const std::string patch_version = "Patch Version";
static const std::string version = "Version";
}
static const std::string patch_engine_version = "1.2";
enum class patch_type enum class patch_type
{ {
invalid,
load, load,
byte, byte,
le16, le16,
@@ -23,22 +41,113 @@ enum class patch_type
class patch_engine class patch_engine
{ {
struct patch public:
struct patch_data
{ {
patch_type type; patch_type type = patch_type::load;
u32 offset; u32 offset = 0;
u64 value; std::string original_value; // Used for import consistency (avoid rounding etc.)
union
{
u64 long_value;
f64 double_value;
} value { 0 };
};
using patch_app_versions = std::unordered_map<std::string /*app_version*/, bool /*enabled*/>;
using patch_serials = std::unordered_map<std::string /*serial*/, patch_app_versions>;
using patch_titles = std::unordered_map<std::string /*serial*/, patch_serials>;
struct patch_info
{
// Patch information
std::vector<patch_data> data_list;
patch_titles titles;
std::string description;
std::string patch_version;
std::string patch_group;
std::string author;
std::string notes;
std::string source_path;
// Redundant information for accessibility (see patch_container)
std::string hash;
std::string version;
bool is_legacy = false;
bool is_enabled = false; // only for legacy patches
}; };
// Database struct patch_container
std::unordered_map<std::string, std::vector<patch>> m_map; {
std::unordered_map<std::string /*description*/, patch_info> patch_info_map;
std::string hash;
std::string version;
bool is_legacy = false;
};
public: using patch_map = std::unordered_map<std::string /*hash*/, patch_container>;
// Load from file
void append(const std::string& path); patch_engine();
// Returns the directory in which patch_config.yml is located
static std::string get_patch_config_path();
// Returns the directory in which patches are located
static std::string get_patches_path();
// Returns the filepath for the imported_patch.yml
static std::string get_imported_patch_path();
// Load from file and append to specified patches map
static bool load(patch_map& patches, const std::string& path, bool importing = false, std::stringstream* log_messages = nullptr);
// Read and add a patch node to the patch info
static bool read_patch_node(patch_info& info, YAML::Node node, const YAML::Node& root, std::stringstream* log_messages = nullptr);
// Get the patch type of a patch node
static patch_type get_patch_type(YAML::Node node);
// Add the data of a patch node
static bool add_patch_data(YAML::Node node, patch_info& info, u32 modifier, const YAML::Node& root, std::stringstream* log_messages = nullptr);
// Save to patch_config.yml
static void save_config(const patch_map& patches_map, bool enable_legacy_patches);
// Save a patch file
static bool save_patches(const patch_map& patches, const std::string& path, std::stringstream* log_messages = nullptr);
// Create or append patches to a file
static bool import_patches(const patch_map& patches, const std::string& path, size_t& count, size_t& total, std::stringstream* log_messages = nullptr);
// Remove a patch from a file
static bool remove_patch(const patch_info& info);
// Load patch_config.yml
static patch_map load_config(bool& enable_legacy_patches);
// Load from file and append to member patches map
void append_global_patches();
// Load from title relevant files and append to member patches map
void append_title_patches(const std::string& title_id);
// Apply patch (returns the number of entries applied) // Apply patch (returns the number of entries applied)
std::size_t apply(const std::string& name, u8* dst) const; std::size_t apply(const std::string& name, u8* dst);
// Apply patch with a check that the address exists in SPU local storage // Apply patch with a check that the address exists in SPU local storage
std::size_t apply_with_ls_check(const std::string&name, u8*dst, u32 filesz, u32 ls_addr) const; std::size_t apply_with_ls_check(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
private:
// Load from file and append to member patches map
void append(const std::string& path);
// Internal: Apply patch (returns the number of entries applied)
template <bool check_local_storage>
std::size_t apply_patch(const std::string& name, u8* dst, u32 filesz, u32 ls_addr);
// Database
patch_map m_map;
// Only one patch per patch group can be applied
std::set<std::string> m_applied_groups;
}; };
+32
View File
@@ -0,0 +1,32 @@
#include "stdafx.h"
#include "cheat_info.h"
#include "Config.h"
#include "StrUtil.h"
LOG_CHANNEL(log_cheat, "Cheat");
bool cheat_info::from_str(const std::string& cheat_line)
{
auto cheat_vec = fmt::split(cheat_line, {"@@@"}, false);
s64 val64 = 0;
if (cheat_vec.size() != 5 || !cfg::try_to_int64(&val64, cheat_vec[2], 0, cheat_type_max - 1))
{
log_cheat.fatal("Failed to parse cheat line");
return false;
}
game = cheat_vec[0];
description = cheat_vec[1];
type = cheat_type{::narrow<u8>(val64)};
offset = std::stoul(cheat_vec[3]);
red_script = cheat_vec[4];
return true;
}
std::string cheat_info::to_str() const
{
std::string cheat_str = game + "@@@" + description + "@@@" + std::to_string(static_cast<u8>(type)) + "@@@" + std::to_string(offset) + "@@@" + red_script + "@@@";
return cheat_str;
}
+30
View File
@@ -0,0 +1,30 @@
#pragma once
#include "stdafx.h"
enum class cheat_type : u8
{
unsigned_8_cheat,
unsigned_16_cheat,
unsigned_32_cheat,
unsigned_64_cheat,
signed_8_cheat,
signed_16_cheat,
signed_32_cheat,
signed_64_cheat,
max
};
constexpr u8 cheat_type_max = static_cast<u8>(cheat_type::max);
struct cheat_info
{
std::string game;
std::string description;
cheat_type type = cheat_type::max;
u32 offset{};
std::string red_script;
bool from_str(const std::string& cheat_line);
std::string to_str() const;
};
+16 -5
View File
@@ -64,6 +64,13 @@ bool utils::has_avx512()
return g_value; return g_value;
} }
bool utils::has_avx512_icl()
{
// Check AVX512IFMA, AVX512VBMI, AVX512VBMI2, AVX512VPOPCNTDQ, AVX512BITALG, AVX512VNNI, AVX512VPCLMULQDQ, AVX512GFNI, AVX512VAES (Icelake-client level support)
static const bool g_value = has_avx512() && (get_cpuid(7, 0)[1] & 0x00200000) == 0x00200000 && (get_cpuid(7, 0)[2] & 0x00005f42) == 0x00005f42;
return g_value;
}
bool utils::has_xop() bool utils::has_xop()
{ {
static const bool g_value = has_avx() && get_cpuid(0x80000001, 0)[2] & 0x800; static const bool g_value = has_avx() && get_cpuid(0x80000001, 0)[2] & 0x800;
@@ -145,12 +152,16 @@ std::string utils::get_system_info()
{ {
result += " | AVX"; result += " | AVX";
if (has_avx2())
{
result += '+';
}
if (has_avx512()) if (has_avx512())
{
result += "-512";
if (has_avx512_icl())
{
result += '+';
}
}
else if (has_avx2())
{ {
result += '+'; result += '+';
} }
+2
View File
@@ -43,6 +43,8 @@ namespace utils
bool has_avx512(); bool has_avx512();
bool has_avx512_icl();
bool has_xop(); bool has_xop();
bool has_clwb(); bool has_clwb();
+60 -8
View File
@@ -18,7 +18,7 @@
#include <array> #include <array>
#ifdef _MSC_VER #ifdef _MSC_VER
#ifndef __cpp_lib_bitops #if !defined(__cpp_lib_bitops) && _MSC_VER < 1928
#define __cpp_lib_bitops #define __cpp_lib_bitops
#endif #endif
#endif #endif
@@ -30,7 +30,7 @@
#ifdef _MSC_VER #ifdef _MSC_VER
#define ASSUME(...) __assume(__VA_ARGS__) // MSVC __assume ignores side-effects #define ASSUME(...) ((__VA_ARGS__) ? void() : __assume(0)) // MSVC __assume ignores side-effects
#define SAFE_BUFFERS __declspec(safebuffers) #define SAFE_BUFFERS __declspec(safebuffers)
#define NEVER_INLINE __declspec(noinline) #define NEVER_INLINE __declspec(noinline)
#define FORCE_INLINE __forceinline #define FORCE_INLINE __forceinline
@@ -40,13 +40,12 @@
#ifdef __clang__ #ifdef __clang__
#if defined(__has_builtin) && __has_builtin(__builtin_assume) #if defined(__has_builtin) && __has_builtin(__builtin_assume)
#pragma clang diagnostic ignored "-Wassume" // ignore the clang "side-effects ignored" warning #define ASSUME(...) ((__VA_ARGS__) ? void() : __builtin_assume(0)) // __builtin_assume (supported by modern clang) ignores side-effects
#define ASSUME(...) __builtin_assume(!!(__VA_ARGS__)) // __builtin_assume (supported by modern clang) ignores side-effects
#endif #endif
#endif #endif
#ifndef ASSUME // gcc and old clang #ifndef ASSUME // gcc and old clang
#define ASSUME(...) do { if (!(__VA_ARGS__)) __builtin_unreachable(); } while (0) // note: the compiler will generate code to evaluate "cond" if the expression is opaque #define ASSUME(...) ((__VA_ARGS__) ? void() : __builtin_unreachable()) // note: the compiler will generate code to evaluate "cond" if the expression is opaque
#endif #endif
#define SAFE_BUFFERS __attribute__((no_stack_protector)) #define SAFE_BUFFERS __attribute__((no_stack_protector))
@@ -77,7 +76,7 @@
#define STR_CASE(...) case __VA_ARGS__: return #__VA_ARGS__ #define STR_CASE(...) case __VA_ARGS__: return #__VA_ARGS__
#define ASSERT(...) do { if(!(__VA_ARGS__)) fmt::raw_error("Assertion failed: " STRINGIZE(__VA_ARGS__) HERE); } while(0) #define ASSERT(...) ((__VA_ARGS__) ? void() : fmt::raw_error("Assertion failed: " STRINGIZE(__VA_ARGS__) HERE))
#if defined(_DEBUG) || defined(_AUDIT) #if defined(_DEBUG) || defined(_AUDIT)
#define AUDIT(...) ASSERT(__VA_ARGS__) #define AUDIT(...) ASSERT(__VA_ARGS__)
@@ -95,6 +94,11 @@ namespace std
{ {
static_assert(sizeof(To) == sizeof(From), "std::bit_cast<>: incompatible type size"); static_assert(sizeof(To) == sizeof(From), "std::bit_cast<>: incompatible type size");
if constexpr ((std::is_same_v<std::remove_const_t<To>, std::remove_const_t<From>> && std::is_constructible_v<To, From>) || (std::is_integral_v<From> && std::is_integral_v<To>))
{
return static_cast<To>(from);
}
To result{}; To result{};
std::memcpy(&result, &from, sizeof(From)); std::memcpy(&result, &from, sizeof(From));
return result; return result;
@@ -126,6 +130,53 @@ using s16 = std::int16_t;
using s32 = std::int32_t; using s32 = std::int32_t;
using s64 = std::int64_t; using s64 = std::int64_t;
#if __APPLE__
namespace std
{
template <typename T, typename = std::enable_if_t<std::is_unsigned_v<T>>>
constexpr int countr_zero(T x) noexcept
{
if (x == 0)
return sizeof(T) * 8;
if constexpr (sizeof(T) <= sizeof(uint))
return __builtin_ctz(x);
else if constexpr (sizeof(T) <= sizeof(ulong))
return __builtin_ctzl(x);
else if constexpr (sizeof(T) <= sizeof(ullong))
return __builtin_ctzll(x);
else
static_assert(sizeof(T) <= sizeof(ullong));
}
template <typename T, typename = std::enable_if_t<std::is_unsigned_v<T>>>
constexpr int countr_one(T x) noexcept
{
return countr_zero<T>(~x);
}
template <typename T, typename = std::enable_if_t<std::is_unsigned_v<T>>>
constexpr int countl_zero(T x) noexcept
{
if (x == 0)
return sizeof(T) * 8;
if constexpr (sizeof(T) <= sizeof(uint))
return __builtin_clz(x) - (sizeof(uint) - sizeof(T)) * 8;
else if constexpr (sizeof(T) <= sizeof(ulong))
return __builtin_clzl(x) - (sizeof(ulong) - sizeof(T)) * 8;
else if constexpr (sizeof(T) <= sizeof(ullong))
return __builtin_clzll(x) - (sizeof(ullong) - sizeof(T)) * 8;
else
static_assert(sizeof(T) <= sizeof(ullong));
}
template <typename T, typename = std::enable_if_t<std::is_unsigned_v<T>>>
constexpr int countl_one(T x) noexcept
{
return countl_zero<T>(~x);
}
}
#endif
using steady_clock = std::conditional< using steady_clock = std::conditional<
std::chrono::high_resolution_clock::is_steady, std::chrono::high_resolution_clock::is_steady,
std::chrono::high_resolution_clock, std::chrono::steady_clock>::type; std::chrono::high_resolution_clock, std::chrono::steady_clock>::type;
@@ -911,11 +962,12 @@ struct cmd64 : any64
static_assert(sizeof(cmd64) == 8 && std::is_trivially_copyable_v<cmd64>, "Incorrect cmd64 type"); static_assert(sizeof(cmd64) == 8 && std::is_trivially_copyable_v<cmd64>, "Incorrect cmd64 type");
// Error code type (return type), implements error reporting. Could be a template. // Error code type (return type), implements error reporting. Could be a template.
struct error_code class error_code
{ {
// Use fixed s32 type for now // Use fixed s32 type for now
s32 value; s32 value;
public:
error_code() = default; error_code() = default;
// Implementation must be provided specially // Implementation must be provided specially
@@ -1005,4 +1057,4 @@ inline constexpr uintmax_t ceil2(T value)
return i + std::min<uintmax_t>(ispow2, 1); return i + std::min<uintmax_t>(ispow2, 1);
} }
} }
} }
+49
View File
@@ -1,6 +1,8 @@
#include "stdafx.h" #include "stdafx.h"
#include "version.h" #include "version.h"
#include <regex>
namespace utils namespace utils
{ {
std::string to_string(version_type type) std::string to_string(version_type type)
@@ -48,4 +50,51 @@ namespace utils
return version; return version;
} }
// Based on https://www.geeksforgeeks.org/compare-two-version-numbers/
int compare_versions(const std::string& v1, const std::string& v2, bool& ok)
{
// Check if both version strings are valid
ok = std::regex_match(v1, std::regex("[0-9.]*")) && std::regex_match(v2, std::regex("[0-9.]*"));
if (!ok)
{
return -1;
}
// vnum stores each numeric part of version
int vnum1 = 0;
int vnum2 = 0;
// Loop until both strings are processed
for (size_t i = 0, j = 0; (i < v1.length() || j < v2.length());)
{
// Storing numeric part of version 1 in vnum1
while (i < v1.length() && v1[i] != '.')
{
vnum1 = vnum1 * 10 + (v1[i] - '0');
i++;
}
// Storing numeric part of version 2 in vnum2
while (j < v2.length() && v2[j] != '.')
{
vnum2 = vnum2 * 10 + (v2[j] - '0');
j++;
}
if (vnum1 > vnum2)
return 1;
if (vnum2 > vnum1)
return -1;
// If equal, reset variables and go for next numeric part
vnum1 = vnum2 = 0;
i++;
j++;
}
return 0;
}
} }
+3
View File
@@ -69,4 +69,7 @@ namespace utils
uint to_hex() const; uint to_hex() const;
std::string to_string() const; std::string to_string() const;
}; };
// Generic version comparison (e.g. 0.0.5 vs 1.3)
int compare_versions(const std::string& v1, const std::string& v2, bool& ok);
} }
+4
View File
@@ -6,3 +6,7 @@ set(ENABLE_HLSL OFF CACHE BOOL "Enables HLSL input support" FORCE)
set(ENABLE_OPT OFF CACHE BOOL "Enables spirv-opt capability if present" FORCE) set(ENABLE_OPT OFF CACHE BOOL "Enables spirv-opt capability if present" FORCE)
set(ENABLE_CTEST OFF CACHE BOOL "Enables testing" FORCE) set(ENABLE_CTEST OFF CACHE BOOL "Enables testing" FORCE)
add_subdirectory(glslang) add_subdirectory(glslang)
set(SKIP_SPIRV_TOOLS_INSTALL ON CACHE BOOL "Skip spirv-tools install" FORCE)
set(SPIRV-Headers_SOURCE_DIR "${CMAKE_CURRENT_SOURCE_DIR}/spirv-headers" CACHE STRING "spirv-headers path" FORCE)
add_subdirectory(spirv-tools)
+7 -12
View File
@@ -38,29 +38,24 @@
</ImportGroup> </ImportGroup>
<PropertyGroup Label="UserMacros"> <PropertyGroup Label="UserMacros">
<CmakeGenerator>"Visual Studio $(VisualStudioVersion.Substring(0,2))"</CmakeGenerator> <CmakeGenerator>"Visual Studio $(VisualStudioVersion.Substring(0,2))"</CmakeGenerator>
<CmakeCLI>cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang</CmakeCLI>
</PropertyGroup> </PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<NMakeBuildCommandLine> <NMakeBuildCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeBuildCommandLine> msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeBuildCommandLine>
<NMakeReBuildCommandLine> <NMakeReBuildCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeReBuildCommandLine> msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeReBuildCommandLine>
<NMakeCleanCommandLine> <NMakeCleanCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeCleanCommandLine> msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m</NMakeCleanCommandLine>
</PropertyGroup> </PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<NMakeBuildCommandLine> <NMakeBuildCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeBuildCommandLine> </NMakeBuildCommandLine>
<NMakeReBuildCommandLine> <NMakeReBuildCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeReBuildCommandLine> </NMakeReBuildCommandLine>
<NMakeCleanCommandLine> <NMakeCleanCommandLine>$(CmakeCLI)
cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT ../glslang
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeCleanCommandLine> </NMakeCleanCommandLine>
</PropertyGroup> </PropertyGroup>
Submodule Vulkan/spirv-tools added at 895927bd3f
@@ -0,0 +1,68 @@
<?xml version="1.0" encoding="utf-8"?>
<Project DefaultTargets="Build" ToolsVersion="14.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003">
<ItemGroup Label="ProjectConfigurations">
<ProjectConfiguration Include="Debug|x64">
<Configuration>Debug</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
<ProjectConfiguration Include="Release|x64">
<Configuration>Release</Configuration>
<Platform>x64</Platform>
</ProjectConfiguration>
</ItemGroup>
<PropertyGroup Label="Globals">
<ProjectGuid>{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}</ProjectGuid>
<Keyword>MakeFileProj</Keyword>
</PropertyGroup>
<Import Project="..\..\common_default.props" />
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.Default.props" />
<Import Project="..\..\common_default_macros.props" />
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="Configuration">
<ConfigurationType>Makefile</ConfigurationType>
<UseDebugLibraries>true</UseDebugLibraries>
</PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'" Label="Configuration">
<ConfigurationType>Makefile</ConfigurationType>
<UseDebugLibraries>false</UseDebugLibraries>
</PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<ImportGroup Label="ExtensionSettings">
</ImportGroup>
<ImportGroup Label="Shared">
</ImportGroup>
<ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
</ImportGroup>
<ImportGroup Label="PropertySheets" Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<Import Project="$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props" Condition="exists('$(UserRootDir)\Microsoft.Cpp.$(Platform).user.props')" Label="LocalAppDataPlatform" />
</ImportGroup>
<PropertyGroup Label="UserMacros">
<CmakeGenerator>"Visual Studio $(VisualStudioVersion.Substring(0,2))"</CmakeGenerator>
<CmakeCLI>cmake -G $(CmakeGenerator) -A x64 -DCMAKE_CONFIGURATION_TYPES="Debug;Release" -DCMAKE_CXX_STANDARD=20 -DLLVM_USE_CRT_DEBUG=MTd -DLLVM_USE_CRT_RELEASE=MT -DSPIRV-Headers_SOURCE_DIR=$([System.IO.Path]::GetFullPath('$(MSBuildThisFileDirectory)../spirv-headers')) ../spirv-tools</CmakeCLI>
<PropsAbsPath>$([System.IO.Path]::GetFullPath('$(MSBuildThisFileDirectory)..\..\common_default.props'))</PropsAbsPath>
</PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<NMakeBuildCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeBuildCommandLine>
<NMakeReBuildCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeReBuildCommandLine>
<NMakeCleanCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m</NMakeCleanCommandLine>
</PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<NMakeBuildCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
</NMakeBuildCommandLine>
<NMakeReBuildCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
</NMakeReBuildCommandLine>
<NMakeCleanCommandLine>$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(PropsAbsPath) /m
</NMakeCleanCommandLine>
</PropertyGroup>
<ItemDefinitionGroup>
</ItemDefinitionGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />
<ImportGroup Label="ExtensionTargets">
</ImportGroup>
</Project>
@@ -0,0 +1,2 @@
<?xml version="1.0" encoding="utf-8"?>
<Project ToolsVersion="4.0" xmlns="http://schemas.microsoft.com/developer/msbuild/2003" />
+4
View File
@@ -96,6 +96,9 @@
<CharacterSet>Unicode</CharacterSet> <CharacterSet>Unicode</CharacterSet>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Label="PropertySheets"> <ImportGroup Label="PropertySheets">
@@ -125,6 +128,7 @@
<ClCompile> <ClCompile>
<PrecompiledHeader>NotUsing</PrecompiledHeader> <PrecompiledHeader>NotUsing</PrecompiledHeader>
<PreprocessorDefinitions>ASMJIT_STATIC;%(PreprocessorDefinitions)</PreprocessorDefinitions> <PreprocessorDefinitions>ASMJIT_STATIC;%(PreprocessorDefinitions)</PreprocessorDefinitions>
<Optimization Condition="'$(Configuration)|$(Platform)'=='Release - LLVM|x64'">MaxSpeed</Optimization>
</ClCompile> </ClCompile>
</ItemDefinitionGroup> </ItemDefinitionGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.targets" />
+30 -22
View File
@@ -31,27 +31,28 @@ jobs:
displayName: ccache displayName: ccache
- bash: | - bash: |
docker pull --quiet rpcs3/rpcs3-travis-xenial:1.2 docker pull --quiet rpcs3/rpcs3-travis-xenial:1.5
docker run \ docker run \
-v $(pwd):/rpcs3 \ -v $(pwd):/rpcs3 \
--env-file .ci/travis.env \ --env-file .ci/travis.env \
-v $CCACHE_DIR:/root/.ccache \ -v $CCACHE_DIR:/root/.ccache \
-v $BUILD_ARTIFACTSTAGINGDIRECTORY:/root/artifacts \ -v $BUILD_ARTIFACTSTAGINGDIRECTORY:/root/artifacts \
rpcs3/rpcs3-travis-xenial:1.2 \ rpcs3/rpcs3-travis-xenial:1.5 \
/rpcs3/.ci/build-linux.sh /rpcs3/.ci/build-linux.sh
displayName: Docker setup and build displayName: Docker setup and build
- publish: $(Build.ArtifactStagingDirectory) - publish: $(Build.ArtifactStagingDirectory)
condition: eq(variables['COMPILER'], 'gcc') condition: and(succeeded(), eq(variables['COMPILER'], 'gcc'))
artifact: RPCS3 for Linux
- job: Windows_Build - job: Windows_Build
variables: variables:
COMPILER: msvc COMPILER: msvc
QT_VER: '5.14.1' QT_VER: '5.14.2'
QT_DATE: '202001240957' QT_DATE: '202003291224'
QTDIR: C:\Qt\$(QT_VER)\msvc2017_64 QTDIR: C:\Qt\$(QT_VER)\msvc2017_64
VULKAN_VER: '1.1.126.0' VULKAN_VER: '1.2.148.1'
VULKAN_SDK_SHA: 'ee86f25580b550390ce46508415e744d62e87e9c0de6cd299998058253a2a4ba' VULKAN_SDK_SHA: '5dbeafbc75c334811720fb50bd6ed7c9afd42afd31cad6be0b84cd8383aa9472'
VULKAN_SDK: C:\VulkanSDK\$(VULKAN_VER) VULKAN_SDK: C:\VulkanSDK\$(VULKAN_VER)
CACHE_DIR: ./cache CACHE_DIR: ./cache
@@ -59,10 +60,15 @@ jobs:
vmImage: "windows-latest" vmImage: "windows-latest"
steps: steps:
- bash: .ci/get_keys-windows.sh
displayName: Get Cache Keys
- task: Cache@2 - task: Cache@2
inputs: inputs:
key: $(Agent.OS) | $(COMPILER) key: $(Agent.OS) | $(COMPILER) | "$(QT_VER)" | $(VULKAN_SDK_SHA) | llvm.lock | glslang.lock
path: $(CACHE_DIR) path: $(CACHE_DIR)
restoreKeys: |
$(Agent.OS) | $(COMPILER)
displayName: Cache displayName: Cache
- bash: .ci/setup-windows.sh - bash: .ci/setup-windows.sh
@@ -71,30 +77,32 @@ jobs:
- bash: .ci/export-azure-vars.sh - bash: .ci/export-azure-vars.sh
displayName: Export Variables displayName: Export Variables
- task: MSBuild@1
inputs:
solution: './Vulkan/spirv-tools-build/spirv-tools-build.vcxproj'
maximumCpuCount: true
platform: x64
configuration: 'Release'
displayName: Compile SPIRV-Tools
- task: VSBuild@1 - task: VSBuild@1
inputs: inputs:
solution: 'rpcs3.sln' solution: 'rpcs3.sln'
msbuildArgs: '/m' maximumCpuCount: true
platform: x64 platform: x64
configuration: 'Release - LLVM' configuration: 'Release - LLVM'
msbuildArgs: '/p:VCToolsVersion=14.25.28610'
displayName: Compile RPCS3 displayName: Compile RPCS3
- bash: .ci/deploy-windows.sh - bash: .ci/deploy-windows.sh
displayName: Pack up build artifacts displayName: Pack up build artifacts
- publish: $(Build.ArtifactStagingDirectory) - publish: $(Build.ArtifactStagingDirectory)
artifact: Windows App Bundle condition: succeeded()
artifact: RPCS3 for Windows
- task: GitHubRelease@1 - bash: .ci/github-upload-windows.sh
condition: eq(variables['Build.SourceBranch'], 'refs/heads/master') condition: and(ne(variables['Build.Reason'], 'PullRequest'), eq(variables['Build.Repository.Name'], 'RPCS3/rpcs3'), eq(variables['Build.SourceBranch'], 'refs/heads/master'))
inputs:
gitHubConnection: 'RPCS3-Token'
repositoryName: 'RPCS3/rpcs3-binaries-win'
releaseNotesFilePath: 'GitHubReleaseMessage.txt'
action: 'create'
target: '7d09e3be30805911226241afbb14f8cdc2eb054e'
tagSource: 'userSpecifiedTag'
tag: 'build-$(Build.SourceVersion)'
title: $(AVVER)
addChangeLog: false
displayName: Push build to GitHub displayName: Push build to GitHub
env:
RPCS3_TOKEN: $(RPCS3-Token)
+465
View File
@@ -0,0 +1,465 @@
/*
Nekotekina Theme for RPCS3 by GooseWing
v1.0
Based on YoRHa Theme for RPCS3
by Ani @ https://github.com/AniLeo
r1 (2018.02.27)
sorry for stealing
*/
/*
Color Scheme
- Kot Programs
8c806a
bd9d86
c1b398
eadfb1
ebe4d2
- Light
ffd785
bfa163
- Dark
705722
5c471c
4d4940
*/
/* Every widget */
QWidget {
font-family: SCE-PS3 Rodin LATIN;
font-size: 9.00pt;
color: #ffd785;
background: transparent;
alternate-background-color: transparent;
}
/* Debugger: Sets font-family to default (any invalid value could be provided) */
#debugger QListWidget, #debugger QTextEdit {
font-family: none;
}
/* Log+TTY: Use flat dark color background with default font for better readability */
#log_frame, #tty_frame {
background: rgba(52, 49, 40, 0.9);
font-size: 8.50pt;
font-family: none;
}
/* Debugger: Restore original font size */
#debugger QListWidget, #debugger QTextEdit {
font-size: 9.50pt;
}
/* LLE: Style QListWidget checkboxes (QListWidget) */
#lleList::indicator {
border: 0.05em solid #4d4940;
}
#lleList::indicator::unchecked {
background-color: #b3ac98;
}
#lleList::indicator::checked {
background-color: #4d4940;
}
#lleList::indicator::disabled {
background-color: #828790;
}
#lleList::item::selected {
color: #4d4940;
}
/* Mouse Tooltips */
QToolTip {
background-color: #705722;
color: #ffd785;
border: 0.10em solid #705722;
}
/* CG Disasm and Trophy Manager: background-image doesn't work, use static color */
QWidget#cg_disasm, QWidget#trophy_manager {
background: #6e695c;
}
/* Main Window and Dialogs */
QDialog, QMainWindow#main_window {
border-image: url("GuiConfigs/kot-bg.jpg");
}
/* Table headers */
QHeaderView::section {
text-transform: uppercase;
background: #bfa163;
color: #4d4940;
padding-left: 0.15em;
padding-top: 0.15em;
padding-bottom: 0.10em;
text-transform: uppercase;
border: none;
}
/* All other Tabs */
QTabBar {
text-transform: uppercase;
}
QTabBar::tab {
background: transparent;
padding-left: 0.50em;
padding-right: 0.50em;
padding-top: 0.25em;
padding-bottom: 0.25em;
margin-right: 0.25em;
}
QTabBar::tab::selected {
background: #705722;
color: #ffd785;
border-bottom-style: solid;
}
/* Settings Dialog: Tabs */
QTabBar#tab_bar_settings {
border-bottom: 0.05em solid #705722;
text-transform: uppercase;
}
QTabBar::tab#tab_bar_settings {
background: transparent;
width: 5.20em;
padding-left: 0.50em;
padding-right: 0.50em;
padding-top: 0.65em;
padding-bottom: 0.65em;
margin-right: 0.25em;
font-size: 10.5pt;
font-weight: 550;
}
QTabBar::tab:last#tab_bar_settings {
margin-right: 0em;
}
QTabBar::tab:!selected:hover#tab_bar_settings {
background: transparent;
color: #705722;
}
QTabBar::tab::selected#tab_bar_settings {
background: #bfa163;
color: #705722;
border-bottom-style: solid;
margin-top: 0.15em;
}
/* Checkboxes */
QCheckBox::indicator {
border-radius: 0.1em;
border: 0.05em solid #5c471c;
margin-top: 0.05em;
width: 0.8em;
height: 0.8em;
}
QCheckBox::indicator:checked {
background-color: #ffd785; /* Light */
}
QCheckBox::indicator:unchecked {
background-color: #705722; /* Dark */
}
QCheckBox::indicator::disabled {
background-color: #828790; /* Gray */
}
/* Radio Buttons */
QRadioButton::indicator {
border-radius: 0.4em;
border: 0.05em solid #5c471c;
width: 0.8em;
height: 0.8em;
}
QRadioButton::indicator:checked {
background-color: #ffd785; /* Light */
}
QRadioButton::indicator:unchecked {
background-color: #705722; /* Dark */
}
QRadioButton::indicator::disabled {
background-color: #828790; /* Gray */
}
/* Combo Boxes */
QComboBox {
background: transparent;
color: #ffd785;
border: 0.05em solid #ffd785;
border-radius: 0.15em;
padding-bottom: 0.2em;
padding-left: 0.4em;
}
QComboBox QAbstractItemView {
background: #bfa163;
color: #4d4940;
}
QComboBox::disabled {
background: #828790;
color: #4d4940;
}
/* Group Boxes (Settings Dialog) */
QGroupBox {
margin-top: 1em;
border: 0.05em solid #ffd785;
text-transform: uppercase;
font-size: 9.25pt;
background-color: rgba(41,41,41,120);
}
QGroupBox::title {
subcontrol-origin: margin;
subcontrol-position: top;
padding: 0.3em 0.5em 0.3em 0.5em;
color: #ffd785;
}
/* Buttons */
QPushButton {
background: #b89754;
color: #292929;
}
QPushButton::disabled {
background: #828790;
color: #ffffff;
}
/* QSpinBox (Settings -> Emulator -> width/height) */
/* QDoubleSpinBox (Pads -> Mouse Acceleration -> x/y) */
QSpinBox, QDoubleSpinBox {
background: transparent;
/*background-color: #bfa163;*/
border: 0.05em solid #4d4940;
border-radius: 0.10em;
color: #ffd785;
}
/* Styles Sliders */
QSlider::groove:horizontal {
border: 0.10em solid #ffd785;
border-radius: 0.10em;
}
QSlider::handle:horizontal {
background: #ffd785;
width: 0.50em;
}
QSlider#sizeSlider::groove:horizontal {
border: 0.10em solid #ffd785;
border-radius: 0.10em;
height: 1.5em;
}
/* Log and Debugger borders */
QTextEdit {
border: 0.05em solid #4d4940;
}
/* For dock buttons to be visible */
QDockWidget {
background: transparent;
text-transform: uppercase;
color: #4d4940;
font-weight: 500;
}
[floating="true"] {
border-image: url("GuiConfigs/kot-bg.jpg");
}
QDockWidget::title {
background: #bfa163;
padding-top: 0.2em;
}
QDockWidget::close-button, QDockWidget::float-button {
background-color: #bfa163;
}
/* Disable ugly borders */
QTabWidget::pane {
border: 0em solid #4d4940;
}
/* Top menu bar */
QMenuBar {
height:1.50em;
text-transform: uppercase;
}
QMenuBar::item {
margin-right: 0.20em;
margin-left: 0.20em;
padding-left: 1.20em;
padding-right: 1.20em;
}
QMenuBar::item:selected {
background: #4d4940;
color: #aea993;
}
QMenu {
background: #bfa163;
color: #4d4940;
text-transform: uppercase;
}
QMenu::item {
padding-left: 1.5em;
padding-right: 0.75em;
padding-top: 0.25em;
padding-bottom: 0.25em;
}
QMenu::item:selected {
background: #4d4940;
color: #aea993;
border: 0.05em solid #4d4940;
}
QMenu::item:disabled {
background-color: #828790;
color: #4d4940;
}
/* Pad Settings: Controller Image */
QLabel#l_controller {
color: #ffd785;
}
/* Game Grid Font */
QTableWidget#game_grid {
font-weight: 600;
color: #4d4940;
text-transform: uppercase;
selection-color: #aea993;
}
QTableWidget#game_grid::item:selected:active {
selection-background-color: #4d4940;
}
QTableWidget#game_grid::item:selected:!active {
selection-background-color: #615c51;
}
/* Debug UI Settings buttons */
QLabel#color_button {
background: transparent;
}
/* Search bar on main Toolbar */
QLineEdit#mw_searchbar {
margin-left: 0.7em;
color: #4d4940;
font-size: 10.25pt;
}
/* Uniform colors in Toolbar */
QToolButton {
background: transparent;
text-transform: uppercase;
}
QToolButton::hover {
background-color: #b3ac98;
}
/* Set Theme UI colors */
QLabel#gamelist_icon_background_color {
color: transparent;
}
/* Set Windows Taskbar Thumbnail colors */
QLabel#thumbnail_icon_color {
color: #4d4940;
}
QLabel#log_level_always {
color: #00ffff; /* Cyan */
}
QLabel#log_level_fatal {
color: #ff00ff; /* Fuchsia */
}
QLabel#log_level_error {
color: #ff0000; /* Red */
}
QLabel#log_level_todo {
color: #ff6000; /* Orange */
}
QLabel#log_level_success {
color: #00ff00; /* Green */
}
QLabel#log_level_warning {
color: #ffff00; /* Yellow */
}
QLabel#log_level_notice {
color: #ffffff; /* White */
}
QLabel#log_level_trace {
color: #808080; /* Gray */
}
QLabel#log_stack {
color: #b3ac98; /* Light */
}
/* Set TTY colors */
#tty_frame {
color: #b3ac98; /* Light */
}
/* Memory Viewer */
QLabel#memory_viewer_address_panel {
color: #0000ff; /* Font Color: Blue */
}
QLabel#memory_viewer_hex_panel {
color: #4d4940; /* Font Color: Grey */
}
QLabel#memory_viewer_ascii_panel {
color: #4d4940; /* Font Color: Grey */
}
/* Debugger colors */
QLabel#debugger_frame_breakpoint {
color: #000000; /* Font Color: Black */
background-color: #ffff00; /* Yellow */
}
QLabel#debugger_frame_pc {
color: #000000; /* Font Color: Black */
background-color: #00ff00; /* Green */
}
/* Trophy Notification Popup */
QWidget#trophy_notification_frame {
background-color: #b3ac98;
color: #4d4940;
}
-4
View File
@@ -460,10 +460,6 @@ QSpinBox:hover, QDoubleSpinBox:hover {
color: #FFFFFF; color: #FFFFFF;
} }
QSpinBox::up-button, QSpinBox::down-button, QDoubleSpinBox::up-button, QDoubleSpinBox::down-button {
background: transparent;
}
QSpinBox:disabled, QDoubleSpinBox:disabled { QSpinBox:disabled, QDoubleSpinBox:disabled {
color: #455971; color: #455971;
background: #26293b; background: #26293b;
-4
View File
@@ -482,10 +482,6 @@ QSpinBox:hover, QDoubleSpinBox:hover {
color: #455971; color: #455971;
} }
QSpinBox::up-button, QSpinBox::down-button, QDoubleSpinBox::up-button, QDoubleSpinBox::down-button {
background: transparent;
}
QSpinBox:disabled, QDoubleSpinBox:disabled { QSpinBox:disabled, QDoubleSpinBox:disabled {
background-color: #b3b3b3; background-color: #b3b3b3;
color: #455971; color: #455971;
+18 -8
View File
@@ -71,6 +71,22 @@ QWidget {
color: #4d4940; color: #4d4940;
} }
/* Style QTreeWidget checkboxes */
QTreeWidget::indicator {
border: 0.05em solid #4d4940;
}
QTreeWidget::indicator::unchecked {
background-color: #b3ac98;
}
QTreeWidget::indicator::checked {
background-color: #4d4940;
}
QTreeWidget::indicator::disabled {
background-color: #828790;
}
QTreeWidget::item::selected {
color: #4d4940;
}
/* Mouse Tooltips */ /* Mouse Tooltips */
QToolTip { QToolTip {
@@ -80,14 +96,8 @@ QToolTip {
} }
/* CG Disasm and Trophy Manager: background-image doesn't work, use static color */ /* Main Window, Dialogs and some Dialogs that are actually widgets */
QWidget#cg_disasm, QWidget#trophy_manager { QDialog, QWidget#trophy_manager, QWidget#cg_disasm, QMainWindow#main_window {
background: #b3ac98;
}
/* Main Window and Dialogs */
QDialog, QMainWindow#main_window {
border-image: url("GuiConfigs/YoRHa-background.jpg"); border-image: url("GuiConfigs/YoRHa-background.jpg");
} }
Binary file not shown.

After

Width:  |  Height:  |  Size: 1.9 MiB

Regular → Executable
View File
Regular → Executable
View File
+9 -12
View File
@@ -26,6 +26,9 @@
<UseDebugLibraries>false</UseDebugLibraries> <UseDebugLibraries>false</UseDebugLibraries>
</PropertyGroup> </PropertyGroup>
<Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" /> <Import Project="$(VCTargetsPath)\Microsoft.Cpp.props" />
<PropertyGroup>
<PreferredToolArchitecture>x64</PreferredToolArchitecture>
</PropertyGroup>
<ImportGroup Label="ExtensionSettings"> <ImportGroup Label="ExtensionSettings">
</ImportGroup> </ImportGroup>
<ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="PropertySheets"> <ImportGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'" Label="PropertySheets">
@@ -41,31 +44,25 @@
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Debug|x64'">
<NMakePreprocessorDefinitions> <NMakePreprocessorDefinitions>
</NMakePreprocessorDefinitions> </NMakePreprocessorDefinitions>
<NMakeBuildCommandLine> <NMakeBuildCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeBuildCommandLine> </NMakeBuildCommandLine>
<NMakeReBuildCommandLine> <NMakeReBuildCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeReBuildCommandLine> </NMakeReBuildCommandLine>
<NMakeCleanCommandLine> <NMakeCleanCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Debug /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeCleanCommandLine> </NMakeCleanCommandLine>
</PropertyGroup> </PropertyGroup>
<PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'"> <PropertyGroup Condition="'$(Configuration)|$(Platform)'=='Release|x64'">
<NMakePreprocessorDefinitions /> <NMakePreprocessorDefinitions />
<NMakeBuildCommandLine> <NMakeBuildCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:build /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeBuildCommandLine> </NMakeBuildCommandLine>
<NMakeReBuildCommandLine> <NMakeReBuildCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:rebuild /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeReBuildCommandLine> </NMakeReBuildCommandLine>
<NMakeCleanCommandLine> <NMakeCleanCommandLine>$(CmakeCLI)
$(CmakeCLI)
msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m msbuild.exe ALL_BUILD.vcxproj /t:clean /p:Configuration=Release /p:ForceImportBeforeCppTargets=$(SolutionDir)common_default.props /m
</NMakeCleanCommandLine> </NMakeCleanCommandLine>
</PropertyGroup> </PropertyGroup>
+8
View File
@@ -93,6 +93,8 @@ Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "libcurl", "3rdparty\libcurl
{73973223-5EE8-41CA-8E88-1D60E89A237B} = {73973223-5EE8-41CA-8E88-1D60E89A237B} {73973223-5EE8-41CA-8E88-1D60E89A237B} = {73973223-5EE8-41CA-8E88-1D60E89A237B}
EndProjectSection EndProjectSection
EndProject EndProject
Project("{8BC9CEB8-8B4A-11D0-8D11-00A0C91BC942}") = "spirv-tools-build", "Vulkan\spirv-tools-build\spirv-tools-build.vcxproj", "{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}"
EndProject
Global Global
GlobalSection(SolutionConfigurationPlatforms) = preSolution GlobalSection(SolutionConfigurationPlatforms) = preSolution
Debug - LLVM|x64 = Debug - LLVM|x64 Debug - LLVM|x64 = Debug - LLVM|x64
@@ -281,6 +283,11 @@ Global
{DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release - LLVM|x64.Build.0 = Release - LLVM|x64 {DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release - LLVM|x64.Build.0 = Release - LLVM|x64
{DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release|x64.ActiveCfg = Release|x64 {DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release|x64.ActiveCfg = Release|x64
{DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release|x64.Build.0 = Release|x64 {DA6F56B4-06A4-441D-AD70-AC5A7D51FADB}.Release|x64.Build.0 = Release|x64
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}.Debug - LLVM|x64.ActiveCfg = Debug|x64
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}.Debug - MemLeak|x64.ActiveCfg = Debug|x64
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}.Debug|x64.ActiveCfg = Debug|x64
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}.Release - LLVM|x64.ActiveCfg = Release|x64
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1}.Release|x64.ActiveCfg = Release|x64
EndGlobalSection EndGlobalSection
GlobalSection(SolutionProperties) = preSolution GlobalSection(SolutionProperties) = preSolution
HideSolutionNode = FALSE HideSolutionNode = FALSE
@@ -304,6 +311,7 @@ Global
{5B146DEA-9ACE-4D32-A7FD-3F42464DD69C} = {CB3DD03E-074E-4FA5-B253-51A3372D1768} {5B146DEA-9ACE-4D32-A7FD-3F42464DD69C} = {CB3DD03E-074E-4FA5-B253-51A3372D1768}
{73973223-5EE8-41CA-8E88-1D60E89A237B} = {6DA34724-E5B2-4306-906D-1A2340637047} {73973223-5EE8-41CA-8E88-1D60E89A237B} = {6DA34724-E5B2-4306-906D-1A2340637047}
{DA6F56B4-06A4-441D-AD70-AC5A7D51FADB} = {BE02DA0B-BEE1-4214-AFA9-3617982F2FEA} {DA6F56B4-06A4-441D-AD70-AC5A7D51FADB} = {BE02DA0B-BEE1-4214-AFA9-3617982F2FEA}
{4CBD3DDD-5555-49A4-A44D-DD3D8CB516A1} = {B0AC29FD-7B01-4B5E-9C8D-0A081E4C5668}
EndGlobalSection EndGlobalSection
GlobalSection(ExtensibilityGlobals) = postSolution GlobalSection(ExtensibilityGlobals) = postSolution
SolutionGuid = {06CC7920-E085-4B81-9582-8DE8AAD42510} SolutionGuid = {06CC7920-E085-4B81-9582-8DE8AAD42510}
+1 -1
View File
@@ -83,7 +83,7 @@ set_target_properties(rpcs3
AUTOUIC ON) AUTOUIC ON)
target_link_libraries(rpcs3 rpcs3_emu rpcs3_ui) target_link_libraries(rpcs3 rpcs3_emu rpcs3_ui)
target_link_libraries(rpcs3 3rdparty::discord-rpc 3rdparty::qt5 3rdparty::hidapi 3rdparty::libusb) target_link_libraries(rpcs3 3rdparty::discord-rpc 3rdparty::qt5 3rdparty::hidapi 3rdparty::libusb 3rdparty::wolfssl)
target_link_libraries(rpcs3 ${ADDITIONAL_LIBS}) target_link_libraries(rpcs3 ${ADDITIONAL_LIBS})
# Win resource file # Win resource file
+57 -75
View File
@@ -2,10 +2,14 @@
#include "key_vault.h" #include "key_vault.h"
#include "unedat.h" #include "unedat.h"
#include "Utilities/mutex.h"
#include <cmath> #include <cmath>
LOG_CHANNEL(edat_log, "EDAT"); LOG_CHANNEL(edat_log, "EDAT");
// Static variables are being modified concurrently in ec.cpp, for now use a mutex
static shared_mutex ec_mtx;
void generate_key(int crypto_mode, int version, unsigned char *key_final, unsigned char *iv_final, unsigned char *key, unsigned char *iv) void generate_key(int crypto_mode, int version, unsigned char *key_final, unsigned char *iv_final, unsigned char *key, unsigned char *iv)
{ {
int mode = crypto_mode & 0xF0000000; int mode = crypto_mode & 0xF0000000;
@@ -131,15 +135,15 @@ std::tuple<u64, s32, s32> dec_section(unsigned char* metadata)
return std::make_tuple(offset, length, compression_end); return std::make_tuple(offset, length, compression_end);
} }
std::array<u8, 0x10> get_block_key(int block, NPD_HEADER *npd) v128 get_block_key(int block, NPD_HEADER *npd)
{ {
unsigned char empty_key[0x10] = {}; unsigned char empty_key[0x10] = {};
unsigned char *src_key = (npd->version <= 1) ? empty_key : npd->dev_hash; unsigned char *src_key = (npd->version <= 1) ? empty_key : npd->dev_hash;
std::array<u8, 0x10> dest_key{}; v128 dest_key{};
memcpy(dest_key.data(), src_key, 0xC); memcpy(dest_key._bytes, src_key, 0xC);
s32 swappedBlock = swap32(block); s32 swappedBlock = swap32(block);
memcpy(&dest_key[0xC], &swappedBlock, sizeof(swappedBlock)); memcpy(&dest_key._bytes[0xC], &swappedBlock, sizeof(swappedBlock));
return dest_key; return dest_key;
} }
@@ -241,10 +245,10 @@ s64 decrypt_block(const fs::file* in, u8* out, EDAT_HEADER *edat, NPD_HEADER *np
in->read(enc_data.get(), length); in->read(enc_data.get(), length);
// Generate a key for the current block. // Generate a key for the current block.
std::array<u8, 0x10> b_key = get_block_key(block_num, npd); auto b_key = get_block_key(block_num, npd);
// Encrypt the block key with the crypto key. // Encrypt the block key with the crypto key.
aesecb128_encrypt(crypt_key, b_key.data(), key_result); aesecb128_encrypt(crypt_key, b_key._bytes, key_result);
if ((edat->flags & EDAT_FLAG_0x10) != 0) if ((edat->flags & EDAT_FLAG_0x10) != 0)
aesecb128_encrypt(crypt_key, key_result, hash); // If FLAG 0x10 is set, encrypt again to get the final hash. aesecb128_encrypt(crypt_key, key_result, hash); // If FLAG 0x10 is set, encrypt again to get the final hash.
else else
@@ -468,6 +472,8 @@ int check_data(unsigned char *key, EDAT_HEADER *edat, NPD_HEADER *npd, const fs:
unsigned char signature_s[0x15] = { 0 }; unsigned char signature_s[0x15] = { 0 };
unsigned char zero_buf[0x15] = { 0 }; unsigned char zero_buf[0x15] = { 0 };
std::lock_guard lock(ec_mtx);
// Setup ECDSA curve and public key. // Setup ECDSA curve and public key.
ecdsa_set_curve(VSH_CURVE_P, VSH_CURVE_A, VSH_CURVE_B, VSH_CURVE_N, VSH_CURVE_GX, VSH_CURVE_GY); ecdsa_set_curve(VSH_CURVE_P, VSH_CURVE_A, VSH_CURVE_B, VSH_CURVE_N, VSH_CURVE_GX, VSH_CURVE_GY);
ecdsa_set_pub(VSH_PUB); ecdsa_set_pub(VSH_PUB);
@@ -518,10 +524,10 @@ int check_data(unsigned char *key, EDAT_HEADER *edat, NPD_HEADER *npd, const fs:
{ {
// Setup header signature hash. // Setup header signature hash.
memset(signature_hash, 0, 20); memset(signature_hash, 0, 20);
std::unique_ptr<u8[]> header_buf(new u8[0xD8]); u8 header_buf[0xD8];
f->seek(file_offset); f->seek(file_offset);
f->read(header_buf.get(), 0xD8); f->read(header_buf, 0xD8);
sha1(header_buf.get(), 0xD8, signature_hash ); sha1(header_buf, 0xD8, signature_hash);
if (!ecdsa_verify(signature_hash, signature_r, signature_s)) if (!ecdsa_verify(signature_hash, signature_r, signature_s))
edat_log.warning("EDAT: Header signature is invalid!"); edat_log.warning("EDAT: Header signature is invalid!");
@@ -534,7 +540,6 @@ int check_data(unsigned char *key, EDAT_HEADER *edat, NPD_HEADER *npd, const fs:
int validate_dev_klic(const u8* klicensee, NPD_HEADER *npd) int validate_dev_klic(const u8* klicensee, NPD_HEADER *npd)
{ {
unsigned char dev[0x60] = { 0 }; unsigned char dev[0x60] = { 0 };
unsigned char key[0x10] = { 0 };
// Build the dev buffer (first 0x60 bytes of NPD header in big-endian). // Build the dev buffer (first 0x60 bytes of NPD header in big-endian).
memcpy(dev, npd, 0x60); memcpy(dev, npd, 0x60);
@@ -548,17 +553,9 @@ int validate_dev_klic(const u8* klicensee, NPD_HEADER *npd)
memcpy(dev + 0xC, &type, 4); memcpy(dev + 0xC, &type, 4);
// Check for an empty dev_hash (can't validate if devklic is NULL); // Check for an empty dev_hash (can't validate if devklic is NULL);
bool isDevklicEmpty = true; auto klic = v128::loadu(klicensee);
for (int i = 0; i < 0x10; i++)
{
if (klicensee[i] != 0)
{
isDevklicEmpty = false;
break;
}
}
if (isDevklicEmpty) if (klic == v128{})
{ {
// Allow empty dev hash. // Allow empty dev hash.
return 1; return 1;
@@ -566,10 +563,10 @@ int validate_dev_klic(const u8* klicensee, NPD_HEADER *npd)
else else
{ {
// Generate klicensee xor key. // Generate klicensee xor key.
xor_key(key, klicensee, NP_OMAC_KEY_2); auto key = klic ^ std::bit_cast<v128>(NP_OMAC_KEY_2);
// Hash with generated key and compare with dev_hash. // Hash with generated key and compare with dev_hash.
return cmac_hash_compare(key, 0x10, dev, 0x60, npd->dev_hash, 0x10); return cmac_hash_compare(key._bytes, 0x10, dev, 0x60, npd->dev_hash, 0x10);
} }
} }
@@ -650,7 +647,7 @@ bool extract_all_data(const fs::file* input, const fs::file* output, const char*
} }
// Set decryption key. // Set decryption key.
u8 key[0x10] = { 0 }; v128 key{};
// Check EDAT/SDAT flag. // Check EDAT/SDAT flag.
if ((EDAT.flags & SDAT_FLAG) == SDAT_FLAG) if ((EDAT.flags & SDAT_FLAG) == SDAT_FLAG)
@@ -664,7 +661,7 @@ bool extract_all_data(const fs::file* input, const fs::file* output, const char*
} }
// Generate SDAT key. // Generate SDAT key.
xor_key(key, NPD.dev_hash, SDAT_KEY); key = std::bit_cast<v128>(NPD.dev_hash) ^ std::bit_cast<v128>(SDAT_KEY);
} }
else else
{ {
@@ -691,23 +688,13 @@ bool extract_all_data(const fs::file* input, const fs::file* output, const char*
// Select EDAT key. // Select EDAT key.
if ((NPD.license & 0x3) == 0x3) // Type 3: Use supplied devklic. if ((NPD.license & 0x3) == 0x3) // Type 3: Use supplied devklic.
memcpy(key, devklic, 0x10); memcpy(&key, devklic, 0x10);
else if ((NPD.license & 0x2) == 0x2) // Type 2: Use key from RAP file (RIF key). else if ((NPD.license & 0x2) == 0x2) // Type 2: Use key from RAP file (RIF key).
{ {
memcpy(key, rifkey, 0x10); memcpy(&key, rifkey, 0x10);
// Make sure we don't have an empty RIF key. // Make sure we don't have an empty RIF key.
int i, test = 0; if (key == v128{})
for (i = 0; i < 0x10; i++)
{
if (key[i] != 0)
{
test = 1;
break;
}
}
if (!test)
{ {
edat_log.error("EDAT: A valid RAP file is needed for this EDAT file!"); edat_log.error("EDAT: A valid RAP file is needed for this EDAT file!");
return 1; return 1;
@@ -721,34 +708,29 @@ bool extract_all_data(const fs::file* input, const fs::file* output, const char*
if (verbose) if (verbose)
{ {
int i; be_t<v128> data;
edat_log.notice("DEVKLIC: ");
for (i = 0; i < 0x10; i++)
edat_log.notice("%02X", devklic[i]);
edat_log.notice("RIF KEY: "); std::memcpy(&data, devklic, sizeof(data));
for (i = 0; i < 0x10; i++) edat_log.notice("DEVKLIC: %s", data);
edat_log.notice("%02X", rifkey[i]); std::memcpy(&data, rifkey, sizeof(data));
edat_log.notice("RIF KEY: %s", data);
} }
} }
if (verbose) if (verbose)
{ {
int i; edat_log.notice("DECRYPTION KEY: %s", std::bit_cast<be_t<v128>>(key));
edat_log.notice("DECRYPTION KEY: ");
for (i = 0; i < 0x10; i++)
edat_log.notice("%02X", key[i]);
} }
input->seek(0); input->seek(0);
if (check_data(key, &EDAT, &NPD, input, verbose)) if (check_data(key._bytes, &EDAT, &NPD, input, verbose))
{ {
edat_log.error("EDAT: Data parsing failed!"); edat_log.error("EDAT: Data parsing failed!");
return 1; return 1;
} }
input->seek(0); input->seek(0);
if (decrypt_data(input, output, &EDAT, &NPD, key, verbose)) if (decrypt_data(input, output, &EDAT, &NPD, key._bytes, verbose))
{ {
edat_log.error("EDAT: Data decryption failed!"); edat_log.error("EDAT: Data decryption failed!");
return 1; return 1;
@@ -757,19 +739,19 @@ bool extract_all_data(const fs::file* input, const fs::file* output, const char*
return 0; return 0;
} }
std::array<u8, 0x10> GetEdatRifKeyFromRapFile(const fs::file& rap_file) v128 GetEdatRifKeyFromRapFile(const fs::file& rap_file)
{ {
std::array<u8, 0x10> rapkey{ 0 }; v128 rapkey{};
std::array<u8, 0x10> rifkey{ 0 }; v128 rifkey{};
rap_file.read<std::array<u8, 0x10>>(rapkey); rap_file.read<v128>(rapkey);
rap_to_rif(rapkey.data(), rifkey.data()); rap_to_rif(rapkey._bytes, rifkey._bytes);
return rifkey; return rifkey;
} }
bool VerifyEDATHeaderWithKLicense(const fs::file& input, const std::string& input_file_name, const std::array<u8, 0x10>& custom_klic, std::string* contentID) bool VerifyEDATHeaderWithKLicense(const fs::file& input, const std::string& input_file_name, const u8* custom_klic, std::string* contentID)
{ {
// Setup NPD and EDAT/SDAT structs. // Setup NPD and EDAT/SDAT structs.
NPD_HEADER NPD; NPD_HEADER NPD;
@@ -794,7 +776,7 @@ bool VerifyEDATHeaderWithKLicense(const fs::file& input, const std::string& inpu
// Perform header validation (EDAT only). // Perform header validation (EDAT only).
char real_file_name[MAX_PATH]; char real_file_name[MAX_PATH];
extract_file_name(input_file_name.c_str(), real_file_name); extract_file_name(input_file_name.c_str(), real_file_name);
if (!validate_npd_hashes(real_file_name, custom_klic.data(), &NPD, false)) if (!validate_npd_hashes(real_file_name, custom_klic, &NPD, false))
{ {
// Ignore header validation in DEBUG data. // Ignore header validation in DEBUG data.
if ((EDAT.flags & EDAT_DEBUG_DATA_FLAG) != EDAT_DEBUG_DATA_FLAG) if ((EDAT.flags & EDAT_DEBUG_DATA_FLAG) != EDAT_DEBUG_DATA_FLAG)
@@ -815,8 +797,8 @@ fs::file DecryptEDAT(const fs::file& input, const std::string& input_file_name,
input.seek(0); input.seek(0);
// Set keys (RIF and DEVKLIC). // Set keys (RIF and DEVKLIC).
std::array<u8, 0x10> rifKey{ 0 }; v128 rifKey{};
unsigned char devklic[0x10] = { 0 }; v128 devklic{};
// Select the EDAT key mode. // Select the EDAT key mode.
switch (mode) switch (mode)
@@ -824,30 +806,30 @@ fs::file DecryptEDAT(const fs::file& input, const std::string& input_file_name,
case 0: case 0:
break; break;
case 1: case 1:
memcpy(devklic, NP_KLIC_FREE, 0x10); memcpy(&devklic, NP_KLIC_FREE, 0x10);
break; break;
case 2: case 2:
memcpy(devklic, NP_OMAC_KEY_2, 0x10); memcpy(&devklic, NP_OMAC_KEY_2, 0x10);
break; break;
case 3: case 3:
memcpy(devklic, NP_OMAC_KEY_3, 0x10); memcpy(&devklic, NP_OMAC_KEY_3, 0x10);
break; break;
case 4: case 4:
memcpy(devklic, NP_KLIC_KEY, 0x10); memcpy(&devklic, NP_KLIC_KEY, 0x10);
break; break;
case 5: case 5:
memcpy(devklic, NP_PSX_KEY, 0x10); memcpy(&devklic, NP_PSX_KEY, 0x10);
break; break;
case 6: case 6:
memcpy(devklic, NP_PSP_KEY_1, 0x10); memcpy(&devklic, NP_PSP_KEY_1, 0x10);
break; break;
case 7: case 7:
memcpy(devklic, NP_PSP_KEY_2, 0x10); memcpy(&devklic, NP_PSP_KEY_2, 0x10);
break; break;
case 8: case 8:
{ {
if (custom_klic != NULL) if (custom_klic != NULL)
memcpy(devklic, custom_klic, 0x10); memcpy(&devklic, custom_klic, 0x10);
else else
{ {
edat_log.error("EDAT: Invalid custom klic!"); edat_log.error("EDAT: Invalid custom klic!");
@@ -870,7 +852,7 @@ fs::file DecryptEDAT(const fs::file& input, const std::string& input_file_name,
// Delete the bad output file if any errors arise. // Delete the bad output file if any errors arise.
fs::file output = fs::make_stream<std::vector<u8>>(); fs::file output = fs::make_stream<std::vector<u8>>();
if (extract_all_data(&input, &output, input_file_name.c_str(), devklic, rifKey.data(), verbose)) if (extract_all_data(&input, &output, input_file_name.c_str(), devklic._bytes, rifKey._bytes, verbose))
{ {
output.release(); output.release();
return fs::file{}; return fs::file{};
@@ -896,12 +878,12 @@ bool EDATADecrypter::ReadHeader()
if ((edatHeader.flags & SDAT_FLAG) == SDAT_FLAG) if ((edatHeader.flags & SDAT_FLAG) == SDAT_FLAG)
{ {
// Generate SDAT key. // Generate SDAT key.
xor_key(dec_key.data(), npdHeader.dev_hash, SDAT_KEY); dec_key = std::bit_cast<v128>(npdHeader.dev_hash) ^ std::bit_cast<v128>(SDAT_KEY);
} }
else else
{ {
// verify key // verify key
if (validate_dev_klic(dev_key.data(), &npdHeader) == 0) if (validate_dev_klic(dev_key._bytes, &npdHeader) == 0)
{ {
edat_log.error("EDAT: Failed validating klic"); edat_log.error("EDAT: Failed validating klic");
return false; return false;
@@ -914,7 +896,7 @@ bool EDATADecrypter::ReadHeader()
{ {
dec_key = std::move(rif_key); dec_key = std::move(rif_key);
if (dec_key == std::array<u8, 0x10>{0}) if (dec_key == v128{})
{ {
edat_log.warning("EDAT: Empty Dec key!"); edat_log.warning("EDAT: Empty Dec key!");
} }
@@ -931,13 +913,13 @@ bool EDATADecrypter::ReadHeader()
// k the ecdsa_verify function in this check_data function takes a ridiculous amount of time // k the ecdsa_verify function in this check_data function takes a ridiculous amount of time
// like it slows down load time by a factor of x20, at least, so its ignored for now // like it slows down load time by a factor of x20, at least, so its ignored for now
/*if (check_data(dec_key.data(), &edatHeader, &npdHeader, &sdata_file, false)) /*if (check_data(dec_key._bytes, &edatHeader, &npdHeader, &sdata_file, false))
{ {
return false; return false;
}*/ }*/
file_size = edatHeader.file_size; file_size = edatHeader.file_size;
total_blocks = static_cast<u32>((edatHeader.file_size + edatHeader.block_size - 1) / edatHeader.block_size); total_blocks = ::aligned_div(edatHeader.file_size, edatHeader.block_size);
return true; return true;
} }
@@ -950,7 +932,7 @@ u64 EDATADecrypter::ReadData(u64 pos, u8* data, u64 size)
// now we need to offset things to account for the actual 'range' requested // now we need to offset things to account for the actual 'range' requested
const u64 startOffset = pos % edatHeader.block_size; const u64 startOffset = pos % edatHeader.block_size;
const u32 num_blocks = static_cast<u32>(std::ceil((startOffset + size) / (0. + edatHeader.block_size))); const u32 num_blocks = static_cast<u32>(::aligned_div(startOffset + size, edatHeader.block_size));
const u64 bufSize = num_blocks*edatHeader.block_size; const u64 bufSize = num_blocks*edatHeader.block_size;
if (data_buf_size < (bufSize)) if (data_buf_size < (bufSize))
{ {
@@ -965,7 +947,7 @@ u64 EDATADecrypter::ReadData(u64 pos, u8* data, u64 size)
for (u32 i = starting_block; i < ending_block; ++i) for (u32 i = starting_block; i < ending_block; ++i)
{ {
edata_file.seek(0); edata_file.seek(0);
u64 res = decrypt_block(&edata_file, &data_buf[writeOffset], &edatHeader, &npdHeader, dec_key.data(), i, total_blocks, edatHeader.file_size); u64 res = decrypt_block(&edata_file, &data_buf[writeOffset], &edatHeader, &npdHeader, dec_key._bytes, i, total_blocks, edatHeader.file_size);
if (res == umax) if (res == umax)
{ {
edat_log.error("Error Decrypting data"); edat_log.error("Error Decrypting data");
+9 -8
View File
@@ -4,6 +4,7 @@
#include "utils.h" #include "utils.h"
#include "Utilities/BEType.h"
#include "Utilities/File.h" #include "Utilities/File.h"
constexpr u32 SDAT_FLAG = 0x01000000; constexpr u32 SDAT_FLAG = 0x01000000;
@@ -16,8 +17,8 @@ constexpr u32 EDAT_DEBUG_DATA_FLAG = 0x80000000;
struct loaded_npdrm_keys struct loaded_npdrm_keys
{ {
std::array<u8, 0x10> devKlic{}; atomic_t<v128> devKlic{};
std::array<u8, 0x10> rifKey{}; atomic_t<v128> rifKey{};
atomic_t<u32> npdrm_fds{0}; atomic_t<u32> npdrm_fds{0};
}; };
@@ -45,9 +46,9 @@ struct EDAT_HEADER
// Decrypts full file, or null/empty file // Decrypts full file, or null/empty file
extern fs::file DecryptEDAT(const fs::file& input, const std::string& input_file_name, int mode, const std::string& rap_file_name, u8 *custom_klic, bool verbose); extern fs::file DecryptEDAT(const fs::file& input, const std::string& input_file_name, int mode, const std::string& rap_file_name, u8 *custom_klic, bool verbose);
extern bool VerifyEDATHeaderWithKLicense(const fs::file& input, const std::string& input_file_name, const std::array<u8,0x10>& custom_klic, std::string* contentID); extern bool VerifyEDATHeaderWithKLicense(const fs::file& input, const std::string& input_file_name, const u8* custom_klic, std::string* contentID);
extern std::array<u8, 0x10> GetEdatRifKeyFromRapFile(const fs::file& rap_file); v128 GetEdatRifKeyFromRapFile(const fs::file& rap_file);
struct EDATADecrypter final : fs::file_base struct EDATADecrypter final : fs::file_base
{ {
@@ -64,17 +65,17 @@ struct EDATADecrypter final : fs::file_base
std::unique_ptr<u8[]> data_buf; std::unique_ptr<u8[]> data_buf;
u64 data_buf_size{0}; u64 data_buf_size{0};
std::array<u8, 0x10> dec_key{}; v128 dec_key{};
// edat usage // edat usage
std::array<u8, 0x10> rif_key{}; v128 rif_key{};
std::array<u8, 0x10> dev_key{}; v128 dev_key{};
public: public:
// SdataByFd usage // SdataByFd usage
EDATADecrypter(fs::file&& input) EDATADecrypter(fs::file&& input)
: edata_file(std::move(input)) {} : edata_file(std::move(input)) {}
// Edat usage // Edat usage
EDATADecrypter(fs::file&& input, const std::array<u8, 0x10>& dev_key, const std::array<u8, 0x10>& rif_key) EDATADecrypter(fs::file&& input, const v128& dev_key, const v128& rif_key)
: edata_file(std::move(input)), rif_key(rif_key), dev_key(dev_key) {} : edata_file(std::move(input)), rif_key(rif_key), dev_key(dev_key) {}
~EDATADecrypter() override {} ~EDATADecrypter() override {}
+40 -9
View File
@@ -535,7 +535,7 @@ package_error package_reader::check_target_app_version()
const auto category = psf::get_string(psf, "CATEGORY", ""); const auto category = psf::get_string(psf, "CATEGORY", "");
const auto title_id = psf::get_string(psf, "TITLE_ID", ""); const auto title_id = psf::get_string(psf, "TITLE_ID", "");
const auto app_ver = psf::get_string(psf, "APP_VER", ""); const auto app_ver = psf::get_string(psf, "APP_VER", "");
auto target_app_ver = psf::get_string(psf, "TARGET_APP_VER", ""); const auto target_app_ver = psf::get_string(psf, "TARGET_APP_VER", "");
if (category != "GD") if (category != "GD")
{ {
@@ -561,7 +561,7 @@ package_error package_reader::check_target_app_version()
return package_error::no_error; return package_error::no_error;
} }
const fs::file installed_sfo_file(Emu.GetHddDir() + "game/" + title_id + "/PARAM.SFO"); const fs::file installed_sfo_file(Emu.GetHddDir() + "game/" + std::string(title_id) + "/PARAM.SFO");
if (!installed_sfo_file) if (!installed_sfo_file)
{ {
if (!target_app_ver.empty()) if (!target_app_ver.empty())
@@ -587,9 +587,9 @@ package_error package_reader::check_target_app_version()
} }
std::add_pointer_t<char> ev0, ev1; std::add_pointer_t<char> ev0, ev1;
const double old_version = std::strtod(installed_app_ver.c_str(), &ev0); const double old_version = std::strtod(installed_app_ver.data(), &ev0);
if (installed_app_ver.c_str() + installed_app_ver.size() != ev0) if (installed_app_ver.data() + installed_app_ver.size() != ev0)
{ {
pkg_log.error("Failed to convert the installed app version to double (%s)", installed_app_ver); pkg_log.error("Failed to convert the installed app version to double (%s)", installed_app_ver);
return package_error::other; return package_error::other;
@@ -599,9 +599,9 @@ package_error package_reader::check_target_app_version()
{ {
// This is most likely the first patch. Let's make sure its version is high enough for the installed game. // This is most likely the first patch. Let's make sure its version is high enough for the installed game.
const double new_version = std::strtod(app_ver.c_str(), &ev1); const double new_version = std::strtod(app_ver.data(), &ev1);
if (app_ver.c_str() + app_ver.size() != ev1) if (app_ver.data() + app_ver.size() != ev1)
{ {
pkg_log.error("Failed to convert the package's app version to double (%s)", app_ver); pkg_log.error("Failed to convert the package's app version to double (%s)", app_ver);
return package_error::other; return package_error::other;
@@ -619,9 +619,9 @@ package_error package_reader::check_target_app_version()
// Check if the installed app version matches the target app version // Check if the installed app version matches the target app version
const double target_version = std::strtod(target_app_ver.c_str(), &ev1); const double target_version = std::strtod(target_app_ver.data(), &ev1);
if (target_app_ver.c_str() + target_app_ver.size() != ev1) if (target_app_ver.data() + target_app_ver.size() != ev1)
{ {
pkg_log.error("Failed to convert the package's target app version to double (%s)", target_app_ver); pkg_log.error("Failed to convert the package's target app version to double (%s)", target_app_ver);
return package_error::other; return package_error::other;
@@ -652,7 +652,36 @@ bool package_reader::extract_data(atomic_t<double>& sync)
} }
// Get full path and create the directory // Get full path and create the directory
const std::string dir = Emulator::GetHddDir() + "game/" + install_dir + '/'; std::string dir = Emulator::GetHddDir();
// Based on https://www.psdevwiki.com/ps3/PKG_files#ContentType
switch (metadata.content_type)
{
case PKG_CONTENT_TYPE_THEME:
dir += "theme/";
break;
case PKG_CONTENT_TYPE_WIDGET:
dir += "widget/";
break;
case PKG_CONTENT_TYPE_LICENSE:
dir += "home/" + Emu.GetUsr() + "/exdata/";
break;
case PKG_CONTENT_TYPE_VSH_MODULE:
dir += "vsh/modules/";
break;
case PKG_CONTENT_TYPE_PSN_AVATAR:
dir += "home/" + Emu.GetUsr() + "/psn_avatar/";
break;
case PKG_CONTENT_TYPE_VMC:
dir += "tmp/vmc/";
break;
// TODO: Find out if other content types are installed elsewhere
default:
dir += "game/";
break;
}
dir += install_dir + '/';
// If false, an existing directory is being overwritten: cannot cancel the operation // If false, an existing directory is being overwritten: cannot cancel the operation
const bool was_null = !fs::is_dir(dir); const bool was_null = !fs::is_dir(dir);
@@ -843,6 +872,8 @@ void package_reader::archive_seek(const s64 new_offset, const fs::seek_mode damo
u64 package_reader::archive_read(void* data_ptr, const u64 num_bytes) u64 package_reader::archive_read(void* data_ptr, const u64 num_bytes)
{ {
ASSERT(filelist.size() > cur_file && filelist[cur_file]);
const u64 num_bytes_left = filelist[cur_file].size() - cur_file_offset; const u64 num_bytes_left = filelist[cur_file].size() - cur_file_offset;
// check if it continues in another file // check if it continues in another file
+35
View File
@@ -34,6 +34,41 @@ enum : u32
PKG_FILE_ENTRY_PSP = 0x10000000, PKG_FILE_ENTRY_PSP = 0x10000000,
}; };
enum : u32
{
PKG_CONTENT_TYPE_UNKNOWN_1 = 0x01, // ?
PKG_CONTENT_TYPE_UNKNOWN_2 = 0x02, // ?
PKG_CONTENT_TYPE_UNKNOWN_3 = 0x03, // ?
PKG_CONTENT_TYPE_GAME_DATA = 0x04, // GameData (also patches)
PKG_CONTENT_TYPE_GAME_EXEC = 0x05, // GameExec
PKG_CONTENT_TYPE_PS1_EMU = 0x06, // PS1emu
PKG_CONTENT_TYPE_PC_ENGINE = 0x07, // PSP & PCEngine
PKG_CONTENT_TYPE_UNKNOWN_4 = 0x08, // ?
PKG_CONTENT_TYPE_THEME = 0x09, // Theme
PKG_CONTENT_TYPE_WIDGET = 0x0A, // Widget
PKG_CONTENT_TYPE_LICENSE = 0x0B, // License
PKG_CONTENT_TYPE_VSH_MODULE = 0x0C, // VSHModule
PKG_CONTENT_TYPE_PSN_AVATAR = 0x0D, // PSN Avatar
PKG_CONTENT_TYPE_PSP_GO = 0x0E, // PSPgo
PKG_CONTENT_TYPE_MINIS = 0x0F, // Minis
PKG_CONTENT_TYPE_NEOGEO = 0x10, // NEOGEO
PKG_CONTENT_TYPE_VMC = 0x11, // VMC
PKG_CONTENT_TYPE_PS2_CLASSIC = 0x12, // ?PS2Classic? Seen on PS2 classic
PKG_CONTENT_TYPE_UNKNOWN_5 = 0x13, // ?
PKG_CONTENT_TYPE_PSP_REMASTERED = 0x14, // ?
PKG_CONTENT_TYPE_PSP2_GD = 0x15, // PSVita Game Data
PKG_CONTENT_TYPE_PSP2_AC = 0x16, // PSVita Additional Content
PKG_CONTENT_TYPE_PSP2_LA = 0x17, // PSVita LiveArea
PKG_CONTENT_TYPE_PSM_1 = 0x18, // PSVita PSM ?
PKG_CONTENT_TYPE_WT = 0x19, // Web TV ?
PKG_CONTENT_TYPE_UNKNOWN_6 = 0x1A, // ?
PKG_CONTENT_TYPE_UNKNOWN_7 = 0x1B, // ?
PKG_CONTENT_TYPE_UNKNOWN_8 = 0x1C, // ?
PKG_CONTENT_TYPE_PSM_2 = 0x1D, // PSVita PSM ?
PKG_CONTENT_TYPE_UNKNOWN_9 = 0x1E, // ?
PKG_CONTENT_TYPE_PSP2_THEME = 0x1F, // PSVita Theme
};
// Structs // Structs
struct PKGHeader struct PKGHeader
{ {
+3 -4
View File
@@ -3,6 +3,7 @@
#include "sha1.h" #include "sha1.h"
#include "utils.h" #include "utils.h"
#include "unself.h" #include "unself.h"
#include "Utilities/BEType.h"
#include "Emu/VFS.h" #include "Emu/VFS.h"
#include "Emu/System.h" #include "Emu/System.h"
@@ -1483,9 +1484,7 @@ bool verify_npdrm_self_headers(const fs::file& self, u8* klic_key)
return true; return true;
} }
std::array<u8, 0x10> get_default_self_klic() v128 get_default_self_klic()
{ {
std::array<u8, 0x10> key; return std::bit_cast<v128>(NP_KLIC_FREE);
std::copy(std::begin(NP_KLIC_FREE), std::end(NP_KLIC_FREE), std::begin(key));
return key;
} }
+3 -1
View File
@@ -508,4 +508,6 @@ private:
fs::file decrypt_self(fs::file elf_or_self, u8* klic_key = nullptr, SelfAdditionalInfo* additional_info = nullptr); fs::file decrypt_self(fs::file elf_or_self, u8* klic_key = nullptr, SelfAdditionalInfo* additional_info = nullptr);
bool verify_npdrm_self_headers(const fs::file& self, u8* klic_key = nullptr); bool verify_npdrm_self_headers(const fs::file& self, u8* klic_key = nullptr);
std::array<u8, 0x10> get_default_self_klic();
union v128;
v128 get_default_self_klic();
-24
View File
@@ -15,14 +15,6 @@
// Auxiliary functions (endian swap, xor). // Auxiliary functions (endian swap, xor).
void xor_key(unsigned char *dest, const u8* src1, const u8* src2)
{
for(int i = 0; i < 0x10; i++)
{
dest[i] = src1[i] ^ src2[i];
}
}
// Hex string conversion auxiliary functions. // Hex string conversion auxiliary functions.
u64 hex_to_u64(const char* hex_str) u64 hex_to_u64(const char* hex_str)
{ {
@@ -67,22 +59,6 @@ void hex_to_bytes(unsigned char* data, const char* hex_str, unsigned int str_len
} }
} }
bool is_hex(const char* hex_str, unsigned int str_length)
{
static const char hex_chars[] = "0123456789abcdefABCDEF";
if (hex_str == NULL)
return false;
unsigned int i;
for (i = 0; i < str_length; i++)
{
if (strchr(hex_chars, hex_str[i]) == 0)
return false;
}
return true;
}
// Crypto functions (AES128-CBC, AES128-ECB, SHA1-HMAC and AES-CMAC). // Crypto functions (AES128-CBC, AES128-ECB, SHA1-HMAC and AES-CMAC).
void aescbc128_decrypt(unsigned char *key, unsigned char *iv, unsigned char *in, unsigned char *out, int len) void aescbc128_decrypt(unsigned char *key, unsigned char *iv, unsigned char *in, unsigned char *out, int len)
-8
View File
@@ -42,19 +42,11 @@ inline u64 swap64(u64 i)
#endif #endif
} }
void xor_key(unsigned char *dest, const u8* src1, const u8* src2);
inline void xor_key_sse(u8* dest, const u8* src1, const u8* src2)
{
_mm_storeu_si128(reinterpret_cast<__m128i*>(dest),
_mm_xor_si128(_mm_loadu_si128(reinterpret_cast<const __m128i*>(src1)), _mm_loadu_si128(reinterpret_cast<const __m128i*>(src2))));
}
char* extract_file_name(const char* file_path, char real_file_name[MAX_PATH]); char* extract_file_name(const char* file_path, char real_file_name[MAX_PATH]);
// Hex string conversion auxiliary functions. // Hex string conversion auxiliary functions.
u64 hex_to_u64(const char* hex_str); u64 hex_to_u64(const char* hex_str);
void hex_to_bytes(unsigned char *data, const char *hex_str, unsigned int str_length); void hex_to_bytes(unsigned char *data, const char *hex_str, unsigned int str_length);
bool is_hex(const char* hex_str, unsigned int str_length);
// Crypto functions (AES128-CBC, AES128-ECB, SHA1-HMAC and AES-CMAC). // Crypto functions (AES128-CBC, AES128-ECB, SHA1-HMAC and AES-CMAC).
void aescbc128_decrypt(unsigned char *key, unsigned char *iv, unsigned char *in, unsigned char *out, int len); void aescbc128_decrypt(unsigned char *key, unsigned char *iv, unsigned char *in, unsigned char *out, int len);
+9 -6
View File
@@ -12,8 +12,7 @@ LOG_CHANNEL(OpenAL);
#define checkForAlcError(sit) do { ALCenum g_last_alc_error = alcGetError(m_device); if(g_last_alc_error != ALC_NO_ERROR) { OpenAL.error("%s: OpenALC error 0x%04x", sit, g_last_alc_error); return; }} while(0) #define checkForAlcError(sit) do { ALCenum g_last_alc_error = alcGetError(m_device); if(g_last_alc_error != ALC_NO_ERROR) { OpenAL.error("%s: OpenALC error 0x%04x", sit, g_last_alc_error); return; }} while(0)
OpenALBackend::OpenALBackend() OpenALBackend::OpenALBackend()
: m_sampling_rate(get_sampling_rate()) : AudioBackend()
, m_sample_size(get_sample_size())
{ {
ALCdevice* m_device = alcOpenDevice(nullptr); ALCdevice* m_device = alcOpenDevice(nullptr);
checkForAlcError("alcOpenDevice"); checkForAlcError("alcOpenDevice");
@@ -24,13 +23,17 @@ OpenALBackend::OpenALBackend()
alcMakeContextCurrent(m_context); alcMakeContextCurrent(m_context);
checkForAlcError("alcMakeContextCurrent"); checkForAlcError("alcMakeContextCurrent");
if (get_channels() == 2) switch (m_channels)
{ {
case 2:
m_format = (m_sample_size == 2) ? AL_FORMAT_STEREO16 : AL_FORMAT_STEREO_FLOAT32; m_format = (m_sample_size == 2) ? AL_FORMAT_STEREO16 : AL_FORMAT_STEREO_FLOAT32;
} break;
else case 6:
{ m_format = (m_sample_size == 2) ? AL_FORMAT_51CHN16 : AL_FORMAT_51CHN32;
break;
default:
m_format = (m_sample_size == 2) ? AL_FORMAT_71CHN16 : AL_FORMAT_71CHN32; m_format = (m_sample_size == 2) ? AL_FORMAT_71CHN16 : AL_FORMAT_71CHN32;
break;
} }
} }
-3
View File
@@ -15,9 +15,6 @@ private:
u32 m_next_buffer = 0; u32 m_next_buffer = 0;
u32 m_num_unqueued = 0; u32 m_num_unqueued = 0;
const u32 m_sampling_rate;
const u32 m_sample_size;
void unqueue_processed(); void unqueue_processed();
public: public:
+7 -6
View File
@@ -1,4 +1,4 @@
#ifndef HAVE_ALSA #ifndef HAVE_ALSA
#error "ALSA support disabled but still being built." #error "ALSA support disabled but still being built."
#endif #endif
@@ -26,6 +26,7 @@ static bool check(int err, const char* reason)
} }
ALSABackend::ALSABackend() ALSABackend::ALSABackend()
: AudioBackend()
{ {
} }
@@ -51,14 +52,14 @@ void ALSABackend::Open(u32 num_buffers)
if (!check(snd_pcm_hw_params_set_access(tls_handle, tls_hw_params, SND_PCM_ACCESS_RW_INTERLEAVED), "snd_pcm_hw_params_set_access")) if (!check(snd_pcm_hw_params_set_access(tls_handle, tls_hw_params, SND_PCM_ACCESS_RW_INTERLEAVED), "snd_pcm_hw_params_set_access"))
return; return;
if (!check(snd_pcm_hw_params_set_format(tls_handle, tls_hw_params, g_cfg.audio.convert_to_u16 ? SND_PCM_FORMAT_S16_LE : SND_PCM_FORMAT_FLOAT_LE), "snd_pcm_hw_params_set_format")) if (!check(snd_pcm_hw_params_set_format(tls_handle, tls_hw_params, m_convert_to_u16 ? SND_PCM_FORMAT_S16_LE : SND_PCM_FORMAT_FLOAT_LE), "snd_pcm_hw_params_set_format"))
return; return;
uint rate = get_sampling_rate(); uint rate = m_sampling_rate;
if (!check(snd_pcm_hw_params_set_rate_near(tls_handle, tls_hw_params, &rate, nullptr), "snd_pcm_hw_params_set_rate_near")) if (!check(snd_pcm_hw_params_set_rate_near(tls_handle, tls_hw_params, &rate, nullptr), "snd_pcm_hw_params_set_rate_near"))
return; return;
if (!check(snd_pcm_hw_params_set_channels(tls_handle, tls_hw_params, get_channels()), "snd_pcm_hw_params_set_channels")) if (!check(snd_pcm_hw_params_set_channels(tls_handle, tls_hw_params, m_channels), "snd_pcm_hw_params_set_channels"))
return; return;
//uint period = 5333; //uint period = 5333;
@@ -92,7 +93,7 @@ void ALSABackend::Open(u32 num_buffers)
if (!check(snd_pcm_sw_params_current(tls_handle, tls_sw_params), "snd_pcm_sw_params_current")) if (!check(snd_pcm_sw_params_current(tls_handle, tls_sw_params), "snd_pcm_sw_params_current"))
return; return;
period_frames *= g_cfg.audio.startt; period_frames *= m_start_threshold;
if (!check(snd_pcm_sw_params_set_start_threshold(tls_handle, tls_sw_params, period_frames + 1), "snd_pcm_sw_params_set_start_threshold")) if (!check(snd_pcm_sw_params_set_start_threshold(tls_handle, tls_sw_params, period_frames + 1), "snd_pcm_sw_params_set_start_threshold"))
return; return;
@@ -132,7 +133,7 @@ void ALSABackend::Close()
bool ALSABackend::AddData(const void* src, u32 num_samples) bool ALSABackend::AddData(const void* src, u32 num_samples)
{ {
u32 num_frames = num_samples / get_channels(); u32 num_frames = num_samples / m_channels;
int res = snd_pcm_writei(tls_handle, src, num_frames); int res = snd_pcm_writei(tls_handle, src, num_frames);
+50 -12
View File
@@ -2,29 +2,67 @@
#include "AudioBackend.h" #include "AudioBackend.h"
#include "Emu/system_config.h" #include "Emu/system_config.h"
/* AudioBackend::AudioBackend()
* Helper methods
*/
u32 AudioBackend::get_sampling_rate()
{ {
m_convert_to_u16 = static_cast<bool>(g_cfg.audio.convert_to_u16);
m_sample_size = m_convert_to_u16 ? sizeof(u16) : sizeof(float);
m_start_threshold = g_cfg.audio.start_threshold;
const u32 sampling_period_multiplier_u32 = g_cfg.audio.sampling_period_multiplier; const u32 sampling_period_multiplier_u32 = g_cfg.audio.sampling_period_multiplier;
if (sampling_period_multiplier_u32 == 100) if (sampling_period_multiplier_u32 == 100)
return DEFAULT_AUDIO_SAMPLING_RATE; {
m_sampling_rate = DEFAULT_AUDIO_SAMPLING_RATE;
}
else
{
const f32 sampling_period_multiplier = sampling_period_multiplier_u32 / 100.0f;
const f32 sampling_rate_multiplier = 1.0f / sampling_period_multiplier;
m_sampling_rate = static_cast<u32>(f32{ DEFAULT_AUDIO_SAMPLING_RATE } *sampling_rate_multiplier);
}
const f32 sampling_period_multiplier = sampling_period_multiplier_u32 / 100.0f; const audio_downmix downmix = g_cfg.audio.audio_channel_downmix.get();
const f32 sampling_rate_multiplier = 1.0f / sampling_period_multiplier;
return static_cast<u32>(f32{DEFAULT_AUDIO_SAMPLING_RATE} * sampling_rate_multiplier); switch (downmix)
{
case audio_downmix::no_downmix:
m_channels = 8;
break;
case audio_downmix::downmix_to_stereo:
m_channels = 2;
break;
case audio_downmix::downmix_to_5_1:
m_channels = 6;
break;
case audio_downmix::use_application_settings:
m_channels = 2; // TODO
break;
default:
fmt::throw_exception("Unknown audio channel mode %s (%d)", downmix, static_cast<int>(downmix));
}
} }
u32 AudioBackend::get_sample_size() /*
* Helper methods
*/
u32 AudioBackend::get_sampling_rate() const
{ {
return g_cfg.audio.convert_to_u16 ? sizeof(u16) : sizeof(float); return m_sampling_rate;
} }
u32 AudioBackend::get_channels() u32 AudioBackend::get_sample_size() const
{ {
return g_cfg.audio.downmix_to_2ch ? 2 : 8; return m_sample_size;
}
u32 AudioBackend::get_channels() const
{
return m_channels;
}
bool AudioBackend::get_convert_to_u16() const
{
return m_convert_to_u16;
} }
bool AudioBackend::has_capability(u32 cap) const bool AudioBackend::has_capability(u32 cap) const
+14 -3
View File
@@ -20,6 +20,8 @@ public:
SET_FREQUENCY_RATIO = 0x8, // Implements SetFrequencyRatio SET_FREQUENCY_RATIO = 0x8, // Implements SetFrequencyRatio
}; };
AudioBackend();
virtual ~AudioBackend() = default; virtual ~AudioBackend() = default;
/* /*
@@ -94,13 +96,22 @@ public:
/* /*
* Helper methods * Helper methods
*/ */
static u32 get_sampling_rate(); u32 get_sampling_rate() const;
static u32 get_sample_size(); u32 get_sample_size() const;
static u32 get_channels(); u32 get_channels() const;
bool get_convert_to_u16() const;
bool has_capability(u32 cap) const; bool has_capability(u32 cap) const;
void dump_capabilities(std::string& out) const; void dump_capabilities(std::string& out) const;
protected:
bool m_convert_to_u16 = false;
u32 m_sample_size = sizeof(float);
u32 m_sampling_rate = DEFAULT_AUDIO_SAMPLING_RATE;
u32 m_channels = 0;
u32 m_start_threshold = 1;
}; };
+9 -1
View File
@@ -1,13 +1,21 @@
#include "stdafx.h" #include "stdafx.h"
#include "AudioDumper.h" #include "AudioDumper.h"
#include "Utilities/date_time.h"
#include "Emu/System.h"
AudioDumper::AudioDumper(u16 ch) AudioDumper::AudioDumper(u16 ch)
: m_header(ch) : m_header(ch)
{ {
if (GetCh()) if (GetCh())
{ {
m_output.open(fs::get_cache_dir() + "audio.wav", fs::rewrite); std::string path = fs::get_cache_dir() + "audio_";
if (const std::string id = Emu.GetTitleID(); !id.empty())
{
path += id + "_";
};
path += date_time::current_time_narrow<'_'>() + ".wav";
m_output.open(path, fs::rewrite);
m_output.write(m_header); // write initial file header m_output.write(m_header); // write initial file header
} }
} }
+11 -14
View File
@@ -1,4 +1,4 @@
#ifndef HAVE_FAUDIO #ifndef HAVE_FAUDIO
#error "FAudio support disabled but still being built." #error "FAudio support disabled but still being built."
#endif #endif
@@ -10,6 +10,7 @@
LOG_CHANNEL(FAudio_, "FAudio"); LOG_CHANNEL(FAudio_, "FAudio");
FAudioBackend::FAudioBackend() FAudioBackend::FAudioBackend()
: AudioBackend()
{ {
u32 res; u32 res;
@@ -20,7 +21,7 @@ FAudioBackend::FAudioBackend()
return; return;
} }
res = FAudio_CreateMasteringVoice(m_instance, &m_master_voice, g_cfg.audio.downmix_to_2ch ? 2 : 8, 48000, 0, 0, nullptr); res = FAudio_CreateMasteringVoice(m_instance, &m_master_voice, m_channels, 48000, 0, 0, nullptr);
if (res) if (res)
{ {
FAudio_.fatal("FAudio_CreateMasteringVoice() failed(0x%08x)", res); FAudio_.fatal("FAudio_CreateMasteringVoice() failed(0x%08x)", res);
@@ -102,17 +103,13 @@ void FAudioBackend::Close()
void FAudioBackend::Open(u32 /* num_buffers */) void FAudioBackend::Open(u32 /* num_buffers */)
{ {
const u32 sample_size = AudioBackend::get_sample_size();
const u32 channels = AudioBackend::get_channels();
const u32 sampling_rate = AudioBackend::get_sampling_rate();
FAudioWaveFormatEx waveformatex; FAudioWaveFormatEx waveformatex;
waveformatex.wFormatTag = g_cfg.audio.convert_to_u16 ? FAUDIO_FORMAT_PCM : FAUDIO_FORMAT_IEEE_FLOAT; waveformatex.wFormatTag = m_convert_to_u16 ? FAUDIO_FORMAT_PCM : FAUDIO_FORMAT_IEEE_FLOAT;
waveformatex.nChannels = channels; waveformatex.nChannels = m_channels;
waveformatex.nSamplesPerSec = sampling_rate; waveformatex.nSamplesPerSec = m_sampling_rate;
waveformatex.nAvgBytesPerSec = static_cast<u32>(sampling_rate * channels * sample_size); waveformatex.nAvgBytesPerSec = static_cast<u32>(m_sampling_rate * m_channels * m_sample_size);
waveformatex.nBlockAlign = channels * sample_size; waveformatex.nBlockAlign = m_channels * m_sample_size;
waveformatex.wBitsPerSample = sample_size * 8; waveformatex.wBitsPerSample = m_sample_size * 8;
waveformatex.cbSize = 0; waveformatex.cbSize = 0;
u32 res = FAudio_CreateSourceVoice(m_instance, &m_source_voice, &waveformatex, 0, FAUDIO_DEFAULT_FREQ_RATIO, nullptr, nullptr, nullptr); u32 res = FAudio_CreateSourceVoice(m_instance, &m_source_voice, &waveformatex, 0, FAUDIO_DEFAULT_FREQ_RATIO, nullptr, nullptr, nullptr);
@@ -123,7 +120,7 @@ void FAudioBackend::Open(u32 /* num_buffers */)
} }
AUDIT(m_source_voice != nullptr); AUDIT(m_source_voice != nullptr);
FAudioVoice_SetVolume(m_source_voice, channels == 2 ? 1.0f : 4.0f, FAUDIO_COMMIT_NOW); FAudioVoice_SetVolume(m_source_voice, 1.0f, FAUDIO_COMMIT_NOW);
} }
bool FAudioBackend::AddData(const void* src, u32 num_samples) bool FAudioBackend::AddData(const void* src, u32 num_samples)
@@ -140,7 +137,7 @@ bool FAudioBackend::AddData(const void* src, u32 num_samples)
} }
FAudioBuffer buffer; FAudioBuffer buffer;
buffer.AudioBytes = num_samples * AudioBackend::get_sample_size(); buffer.AudioBytes = num_samples * m_sample_size;
buffer.Flags = 0; buffer.Flags = 0;
buffer.LoopBegin = FAUDIO_NO_LOOP_REGION; buffer.LoopBegin = FAUDIO_NO_LOOP_REGION;
buffer.LoopCount = 0; buffer.LoopCount = 0;
+24 -10
View File
@@ -1,4 +1,4 @@
#ifndef HAVE_PULSE #ifndef HAVE_PULSE
#error "PulseAudio support disabled but still being built." #error "PulseAudio support disabled but still being built."
#endif #endif
@@ -9,6 +9,7 @@
#include <pulse/error.h> #include <pulse/error.h>
PulseBackend::PulseBackend() PulseBackend::PulseBackend()
: AudioBackend()
{ {
} }
@@ -19,7 +20,8 @@ PulseBackend::~PulseBackend()
void PulseBackend::Close() void PulseBackend::Close()
{ {
if(this->connection) { if (this->connection)
{
pa_simple_free(this->connection); pa_simple_free(this->connection);
this->connection = nullptr; this->connection = nullptr;
} }
@@ -28,20 +30,30 @@ void PulseBackend::Close()
void PulseBackend::Open(u32 /* num_buffers */) void PulseBackend::Open(u32 /* num_buffers */)
{ {
pa_sample_spec ss; pa_sample_spec ss;
ss.format = (get_sample_size() == 2) ? PA_SAMPLE_S16LE : PA_SAMPLE_FLOAT32LE; ss.format = (m_sample_size == 2) ? PA_SAMPLE_S16LE : PA_SAMPLE_FLOAT32LE;
ss.rate = get_sampling_rate(); ss.rate = m_sampling_rate;
pa_channel_map channel_map; pa_channel_map channel_map;
if (get_channels() == 2) if (m_channels == 2)
{ {
channel_map.channels = 2; channel_map.channels = 2;
channel_map.map[0] = PA_CHANNEL_POSITION_FRONT_LEFT; channel_map.map[0] = PA_CHANNEL_POSITION_FRONT_LEFT;
channel_map.map[1] = PA_CHANNEL_POSITION_FRONT_RIGHT; channel_map.map[1] = PA_CHANNEL_POSITION_FRONT_RIGHT;
} }
else if (m_channels == 6)
{
channel_map.channels = 6;
channel_map.map[0] = PA_CHANNEL_POSITION_FRONT_LEFT;
channel_map.map[1] = PA_CHANNEL_POSITION_FRONT_RIGHT;
channel_map.map[2] = PA_CHANNEL_POSITION_FRONT_CENTER;
channel_map.map[3] = PA_CHANNEL_POSITION_LFE;
channel_map.map[4] = PA_CHANNEL_POSITION_REAR_LEFT;
channel_map.map[5] = PA_CHANNEL_POSITION_REAR_RIGHT;
}
else else
{ {
channel_map.channels = 8; channel_map.channels = 8;
channel_map.map[0] = PA_CHANNEL_POSITION_FRONT_LEFT; channel_map.map[0] = PA_CHANNEL_POSITION_FRONT_LEFT;
channel_map.map[1] = PA_CHANNEL_POSITION_FRONT_RIGHT; channel_map.map[1] = PA_CHANNEL_POSITION_FRONT_RIGHT;
channel_map.map[2] = PA_CHANNEL_POSITION_FRONT_CENTER; channel_map.map[2] = PA_CHANNEL_POSITION_FRONT_CENTER;
@@ -55,7 +67,8 @@ void PulseBackend::Open(u32 /* num_buffers */)
int err; int err;
this->connection = pa_simple_new(NULL, "RPCS3", PA_STREAM_PLAYBACK, NULL, "Game", &ss, &channel_map, NULL, &err); this->connection = pa_simple_new(NULL, "RPCS3", PA_STREAM_PLAYBACK, NULL, "Game", &ss, &channel_map, NULL, &err);
if(!this->connection) { if (!this->connection)
{
fprintf(stderr, "PulseAudio: Failed to initialize audio: %s\n", pa_strerror(err)); fprintf(stderr, "PulseAudio: Failed to initialize audio: %s\n", pa_strerror(err));
} }
} }
@@ -65,10 +78,11 @@ bool PulseBackend::AddData(const void* src, u32 num_samples)
AUDIT(this->connection); AUDIT(this->connection);
int err; int err;
if(pa_simple_write(this->connection, src, num_samples * get_sample_size(), &err) < 0) { if (pa_simple_write(this->connection, src, num_samples * m_sample_size, &err) < 0)
{
fprintf(stderr, "PulseAudio: Failed to write audio stream: %s\n", pa_strerror(err)); fprintf(stderr, "PulseAudio: Failed to write audio stream: %s\n", pa_strerror(err));
return false; return false;
} }
return true; return true;
} }
+23 -21
View File
@@ -9,26 +9,32 @@
#include "XAudio2Backend.h" #include "XAudio2Backend.h"
#include <Windows.h> #include <Windows.h>
#include <system_error>
#pragma comment(lib, "xaudio2_9redist.lib") #pragma comment(lib, "xaudio2_9redist.lib")
LOG_CHANNEL(XAudio); LOG_CHANNEL(XAudio);
XAudio2Backend::XAudio2Backend() XAudio2Backend::XAudio2Backend()
: AudioBackend()
{ {
Microsoft::WRL::ComPtr<IXAudio2> instance; Microsoft::WRL::ComPtr<IXAudio2> instance;
// In order to prevent errors on CreateMasteringVoice, apparently we need CoInitializeEx according to:
// https://docs.microsoft.com/en-us/windows/win32/api/xaudio2fx/nf-xaudio2fx-xaudio2createvolumemeter
CoInitializeEx(NULL, COINIT_MULTITHREADED);
HRESULT hr = XAudio2Create(instance.GetAddressOf(), 0, XAUDIO2_DEFAULT_PROCESSOR); HRESULT hr = XAudio2Create(instance.GetAddressOf(), 0, XAUDIO2_DEFAULT_PROCESSOR);
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("XAudio2Create() failed(0x%08x)", (u32)hr); XAudio.error("XAudio2Create() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
return; return;
} }
hr = instance->CreateMasteringVoice(&m_master_voice, g_cfg.audio.downmix_to_2ch ? 2 : 8, 48000); hr = instance->CreateMasteringVoice(&m_master_voice, m_channels, 48000);
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("CreateMasteringVoice() failed(0x%08x)", (u32)hr); XAudio.error("CreateMasteringVoice() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
return; return;
} }
@@ -62,7 +68,7 @@ void XAudio2Backend::Play()
HRESULT hr = m_source_voice->Start(); HRESULT hr = m_source_voice->Start();
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("Start() failed(0x%08x)", (u32)hr); XAudio.error("Start() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
} }
} }
@@ -80,7 +86,7 @@ void XAudio2Backend::Pause()
HRESULT hr = m_source_voice->Stop(); HRESULT hr = m_source_voice->Stop();
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("Stop() failed(0x%08x)", (u32)hr); XAudio.error("Stop() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
} }
} }
@@ -89,29 +95,25 @@ void XAudio2Backend::Open(u32 /* num_buffers */)
{ {
HRESULT hr; HRESULT hr;
const u32 sample_size = AudioBackend::get_sample_size();
const u32 channels = AudioBackend::get_channels();
const u32 sampling_rate = AudioBackend::get_sampling_rate();
WAVEFORMATEX waveformatex; WAVEFORMATEX waveformatex;
waveformatex.wFormatTag = g_cfg.audio.convert_to_u16 ? WAVE_FORMAT_PCM : WAVE_FORMAT_IEEE_FLOAT; waveformatex.wFormatTag = m_convert_to_u16 ? WAVE_FORMAT_PCM : WAVE_FORMAT_IEEE_FLOAT;
waveformatex.nChannels = channels; waveformatex.nChannels = m_channels;
waveformatex.nSamplesPerSec = sampling_rate; waveformatex.nSamplesPerSec = m_sampling_rate;
waveformatex.nAvgBytesPerSec = static_cast<DWORD>(sampling_rate * channels * sample_size); waveformatex.nAvgBytesPerSec = static_cast<DWORD>(m_sampling_rate * m_channels * m_sample_size);
waveformatex.nBlockAlign = channels * sample_size; waveformatex.nBlockAlign = m_channels * m_sample_size;
waveformatex.wBitsPerSample = sample_size * 8; waveformatex.wBitsPerSample = m_sample_size * 8;
waveformatex.cbSize = 0; waveformatex.cbSize = 0;
hr = m_xaudio2_instance->CreateSourceVoice(&m_source_voice, &waveformatex, 0, XAUDIO2_DEFAULT_FREQ_RATIO); hr = m_xaudio2_instance->CreateSourceVoice(&m_source_voice, &waveformatex, 0, XAUDIO2_DEFAULT_FREQ_RATIO);
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("CreateSourceVoice() failed(0x%08x)", (u32)hr); XAudio.error("CreateSourceVoice() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
return; return;
} }
AUDIT(m_source_voice != nullptr); AUDIT(m_source_voice != nullptr);
m_source_voice->SetVolume(channels == 2 ? 1.0f : 4.0f); m_source_voice->SetVolume(1.0f);
} }
bool XAudio2Backend::IsPlaying() bool XAudio2Backend::IsPlaying()
@@ -139,7 +141,7 @@ bool XAudio2Backend::AddData(const void* src, u32 num_samples)
XAUDIO2_BUFFER buffer; XAUDIO2_BUFFER buffer;
buffer.AudioBytes = num_samples * AudioBackend::get_sample_size(); buffer.AudioBytes = num_samples * m_sample_size;
buffer.Flags = 0; buffer.Flags = 0;
buffer.LoopBegin = XAUDIO2_NO_LOOP_REGION; buffer.LoopBegin = XAUDIO2_NO_LOOP_REGION;
buffer.LoopCount = 0; buffer.LoopCount = 0;
@@ -152,7 +154,7 @@ bool XAudio2Backend::AddData(const void* src, u32 num_samples)
HRESULT hr = m_source_voice->SubmitSourceBuffer(&buffer); HRESULT hr = m_source_voice->SubmitSourceBuffer(&buffer);
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("AddData() failed(0x%08x)", (u32)hr); XAudio.error("AddData() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
return false; return false;
} }
@@ -167,7 +169,7 @@ void XAudio2Backend::Flush()
HRESULT hr = m_source_voice->FlushSourceBuffers(); HRESULT hr = m_source_voice->FlushSourceBuffers();
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("FlushSourceBuffers() failed(0x%08x)", (u32)hr); XAudio.error("FlushSourceBuffers() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
} }
} }
@@ -190,7 +192,7 @@ f32 XAudio2Backend::SetFrequencyRatio(f32 new_ratio)
HRESULT hr = m_source_voice->SetFrequencyRatio(new_ratio); HRESULT hr = m_source_voice->SetFrequencyRatio(new_ratio);
if (FAILED(hr)) if (FAILED(hr))
{ {
XAudio.error("SetFrequencyRatio() failed(0x%08x)", (u32)hr); XAudio.error("SetFrequencyRatio() failed: %s (0x%08x)", std::system_category().message(hr), static_cast<u32>(hr));
Emu.Pause(); Emu.Pause();
return 1.0f; return 1.0f;
} }
+7 -2
View File
@@ -12,7 +12,7 @@ target_link_libraries(rpcs3_emu
PRIVATE PRIVATE
3rdparty::zlib 3rdparty::yaml-cpp 3rdparty::zlib 3rdparty::yaml-cpp
PUBLIC PUBLIC
3rdparty::libevdev) 3rdparty::libevdev 3rdparty::flatbuffers)
find_package(Threads REQUIRED) find_package(Threads REQUIRED)
@@ -35,6 +35,7 @@ target_sources(rpcs3_emu PRIVATE
../util/yaml.cpp ../util/yaml.cpp
../util/cereal.cpp ../util/cereal.cpp
../../Utilities/bin_patch.cpp ../../Utilities/bin_patch.cpp
../../Utilities/cheat_info.cpp
../../Utilities/cond.cpp ../../Utilities/cond.cpp
../../Utilities/Config.cpp ../../Utilities/Config.cpp
../../Utilities/dynamic_library.cpp ../../Utilities/dynamic_library.cpp
@@ -361,7 +362,11 @@ target_sources(rpcs3_emu PRIVATE
# Np # Np
target_sources(rpcs3_emu PRIVATE target_sources(rpcs3_emu PRIVATE
NP/fb_helpers.cpp
NP/np_handler.cpp NP/np_handler.cpp
NP/np_structs_extra.cpp
NP/rpcn_client.cpp
NP/rpcn_config.cpp
) )
# Memory # Memory
@@ -451,7 +456,7 @@ target_link_libraries(rpcs3_emu
3rdparty::ffmpeg 3rdparty::cereal 3rdparty::ffmpeg 3rdparty::cereal
3rdparty::opengl 3rdparty::stblib 3rdparty::opengl 3rdparty::stblib
3rdparty::vulkan 3rdparty::glew 3rdparty::vulkan 3rdparty::glew
3rdparty::libusb 3rdparty::libusb 3rdparty::wolfssl
PRIVATE PRIVATE
3rdparty::span 3rdparty::xxhash 3rdparty::span 3rdparty::xxhash
) )
+17 -1
View File
@@ -56,7 +56,23 @@ protected:
virtual u32 DisAsmBranchTarget(const s32 imm) = 0; virtual u32 DisAsmBranchTarget(const s32 imm) = 0;
std::string FixOp(std::string op) // TODO: Add builtin fmt helpper for best performance
template <typename T, std::enable_if_t<std::is_integral_v<T>, int> = 0>
static std::string SignedHex(T value)
{
const auto v = static_cast<std::make_signed_t<T>>(value);
const auto av = std::abs(v);
if (av < 10)
{
// Does not need hex
return fmt::format("%d", v);
}
return fmt::format("%s%s", v < 0 ? "-" : "", av);
}
static std::string FixOp(std::string op)
{ {
op.resize(std::max<std::size_t>(op.length(), 10), ' '); op.resize(std::max<std::size_t>(op.length(), 10), ' ');
return op; return op;
+68 -60
View File
@@ -332,14 +332,13 @@ void cpu_thread::operator()()
{ {
thread_ctrl::set_thread_affinity_mask(thread_ctrl::get_affinity_mask(id_type() == 1 ? thread_class::ppu : thread_class::spu)); thread_ctrl::set_thread_affinity_mask(thread_ctrl::get_affinity_mask(id_type() == 1 ? thread_class::ppu : thread_class::spu));
} }
if (g_cfg.core.lower_spu_priority && id_type() == 2)
{
thread_ctrl::set_native_priority(-1);
}
if (id_type() == 2) if (id_type() == 2)
{ {
if (g_cfg.core.lower_spu_priority)
{
thread_ctrl::set_native_priority(-1);
}
// force input/output denormals to zero for SPU threads (FTZ/DAZ) // force input/output denormals to zero for SPU threads (FTZ/DAZ)
_mm_setcsr( _mm_getcsr() | 0x8040 ); _mm_setcsr( _mm_getcsr() | 0x8040 );
@@ -434,11 +433,21 @@ void cpu_thread::operator()()
if (!(state & cpu_flag::stop)) if (!(state & cpu_flag::stop))
{ {
cpu_task(); cpu_task();
state -= cpu_flag::ret;
if (state & cpu_flag::ret && state.test_and_reset(cpu_flag::ret))
{
cpu_return();
}
continue; continue;
} }
thread_ctrl::wait(); thread_ctrl::wait();
if (state & cpu_flag::ret && state.test_and_reset(cpu_flag::ret))
{
cpu_return();
}
} }
// Complete cleanup gracefully // Complete cleanup gracefully
@@ -465,63 +474,71 @@ bool cpu_thread::check_state() noexcept
} }
bool cpu_sleep_called = false; bool cpu_sleep_called = false;
bool cpu_flag_memory = false; bool escape, retval;
if (!(state & cpu_flag::wait))
{
state += cpu_flag::wait;
}
while (true) while (true)
{ {
if (state & cpu_flag::memory) // Process all flags in a single atomic op
const auto state0 = state.fetch_op([&](bs_t<cpu_flag>& flags)
{ {
if (auto& ptr = vm::g_tls_locked) bool store = false;
if (flags & cpu_flag::signal)
{ {
ptr->compare_and_swap(this, nullptr); flags -= cpu_flag::signal;
ptr = nullptr; cpu_sleep_called = false;
store = true;
} }
cpu_flag_memory = true;
state -= cpu_flag::memory;
}
if (state & (cpu_flag::exit + cpu_flag::dbg_global_stop))
{
state += cpu_flag::wait;
return true;
}
const auto [state0, escape] = state.fetch_op([&](bs_t<cpu_flag>& flags)
{
// Atomically clean wait flag and escape // Atomically clean wait flag and escape
if (!(flags & (cpu_flag::exit + cpu_flag::dbg_global_stop + cpu_flag::ret + cpu_flag::stop))) if (!(flags & (cpu_flag::exit + cpu_flag::dbg_global_stop + cpu_flag::ret + cpu_flag::stop)))
{ {
// Check pause flags which hold thread inside check_state // Check pause flags which hold thread inside check_state
if (flags & (cpu_flag::pause + cpu_flag::suspend + cpu_flag::dbg_global_pause + cpu_flag::dbg_pause)) if (flags & (cpu_flag::pause + cpu_flag::suspend + cpu_flag::dbg_global_pause + cpu_flag::dbg_pause + cpu_flag::memory))
{ {
return false; if (!(flags & cpu_flag::wait))
{
flags += cpu_flag::wait;
store = true;
}
escape = false;
return store;
} }
flags -= cpu_flag::wait; if (flags & cpu_flag::wait)
{
flags -= cpu_flag::wait;
store = true;
}
retval = false;
}
else
{
if (!(flags & cpu_flag::wait))
{
flags += cpu_flag::wait;
store = true;
}
retval = true;
} }
return true; if (flags & cpu_flag::dbg_step)
}); {
flags += cpu_flag::dbg_pause;
flags -= cpu_flag::dbg_step;
store = true;
}
if (state & cpu_flag::signal && state.test_and_reset(cpu_flag::signal)) escape = true;
{ return store;
cpu_sleep_called = false; }).first;
}
if (escape) if (escape)
{ {
if (cpu_flag_memory) return retval;
{
cpu_mem();
}
break;
} }
else if (!cpu_sleep_called && state0 & cpu_flag::suspend) else if (!cpu_sleep_called && state0 & cpu_flag::suspend)
{ {
@@ -536,25 +553,16 @@ bool cpu_thread::check_state() noexcept
} }
else else
{ {
if (state0 & cpu_flag::memory)
{
vm::passive_lock(*this);
continue;
}
// If only cpu_flag::pause was set, notification won't arrive // If only cpu_flag::pause was set, notification won't arrive
g_fxo->get<cpu_counter>()->cpu_suspend_lock.lock_unlock(); g_fxo->get<cpu_counter>()->cpu_suspend_lock.lock_unlock();
} }
} }
const auto state_ = state.load();
if (state_ & (cpu_flag::ret + cpu_flag::stop))
{
return true;
}
if (state_ & cpu_flag::dbg_step)
{
state += cpu_flag::dbg_pause;
state -= cpu_flag::dbg_step;
}
return false;
} }
void cpu_thread::notify() void cpu_thread::notify()
@@ -623,7 +631,7 @@ std::string cpu_thread::dump_callstack() const
return {}; return {};
} }
std::vector<u32> cpu_thread::dump_callstack_list() const std::vector<std::pair<u32, u32>> cpu_thread::dump_callstack_list() const
{ {
return {}; return {};
} }
+4 -1
View File
@@ -103,7 +103,7 @@ public:
virtual std::string dump_callstack() const; virtual std::string dump_callstack() const;
// Get CPU call stack list // Get CPU call stack list
virtual std::vector<u32> dump_callstack_list() const; virtual std::vector<std::pair<u32, u32>> dump_callstack_list() const;
// Get CPU dump of misc information // Get CPU dump of misc information
virtual std::string dump_misc() const; virtual std::string dump_misc() const;
@@ -120,6 +120,9 @@ public:
// Callback for vm::temporary_unlock // Callback for vm::temporary_unlock
virtual void cpu_unmem() {} virtual void cpu_unmem() {}
// Callback for cpu_flag::ret
virtual void cpu_return() {}
// Thread locker // Thread locker
class suspend_all class suspend_all
{ {
+43 -6
View File
@@ -4,9 +4,9 @@
llvm::LLVMContext g_llvm_ctx; llvm::LLVMContext g_llvm_ctx;
cpu_translator::cpu_translator(llvm::Module* module, bool is_be) cpu_translator::cpu_translator(llvm::Module* _module, bool is_be)
: m_context(g_llvm_ctx) : m_context(g_llvm_ctx)
, m_module(module) , m_module(_module)
, m_is_be(is_be) , m_is_be(is_be)
{ {
} }
@@ -57,6 +57,15 @@ void cpu_translator::initialize(llvm::LLVMContext& context, llvm::ExecutionEngin
{ {
m_use_fma = true; m_use_fma = true;
} }
// Test AVX-512_icelake features (TODO)
if (cpu == "icelake" ||
cpu == "icelake-client" ||
cpu == "icelake-server" ||
cpu == "tigerlake")
{
m_use_avx512_icl = true;
}
} }
llvm::Value* cpu_translator::bitcast(llvm::Value* val, llvm::Type* type) llvm::Value* cpu_translator::bitcast(llvm::Value* val, llvm::Type* type)
@@ -83,12 +92,31 @@ llvm::Value* cpu_translator::bitcast(llvm::Value* val, llvm::Type* type)
} }
template <> template <>
v128 cpu_translator::get_const_vector<v128>(llvm::Constant* c, u32 a, u32 b) std::pair<bool, v128> cpu_translator::get_const_vector<v128>(llvm::Value* c, u32 a, u32 b)
{ {
v128 result{};
if (!llvm::isa<llvm::Constant>(c))
{
return {false, result};
}
const auto t = c->getType(); const auto t = c->getType();
if (!t->isVectorTy()) if (!t->isVectorTy())
{ {
if (const auto ci = llvm::dyn_cast<llvm::ConstantInt>(c); ci && ci->getBitWidth() == 128)
{
auto cv = ci->getValue();
for (int i = 0; i < 128; i++)
{
result._bit[i] = cv[i];
}
return {true, result};
}
fmt::throw_exception("[0x%x, %u] Not a vector" HERE, a, b); fmt::throw_exception("[0x%x, %u] Not a vector" HERE, a, b);
} }
@@ -106,13 +134,17 @@ v128 cpu_translator::get_const_vector<v128>(llvm::Constant* c, u32 a, u32 b)
return {}; return {};
} }
if (llvm::isa<llvm::ConstantExpr>(c))
{
// Sorry, if we cannot evaluate it we cannot use it
fmt::throw_exception("[0x%x, %u] Constant Expression!" HERE, a, b);
}
fmt::throw_exception("[0x%x, %u] Unexpected constant type" HERE, a, b); fmt::throw_exception("[0x%x, %u] Unexpected constant type" HERE, a, b);
} }
const auto sct = t->getScalarType(); const auto sct = t->getScalarType();
v128 result;
if (sct->isIntegerTy(8)) if (sct->isIntegerTy(8))
{ {
for (u32 i = 0; i < 16; i++) for (u32 i = 0; i < 16; i++)
@@ -160,12 +192,17 @@ v128 cpu_translator::get_const_vector<v128>(llvm::Constant* c, u32 a, u32 b)
fmt::throw_exception("[0x%x, %u] Unexpected vector element type" HERE, a, b); fmt::throw_exception("[0x%x, %u] Unexpected vector element type" HERE, a, b);
} }
return result; return {true, result};
} }
template <> template <>
llvm::Constant* cpu_translator::make_const_vector<v128>(v128 v, llvm::Type* t) llvm::Constant* cpu_translator::make_const_vector<v128>(v128 v, llvm::Type* t)
{ {
if (const auto ct = llvm::dyn_cast<llvm::IntegerType>(t); ct && ct->getBitWidth() == 128)
{
return llvm::ConstantInt::get(t, llvm::APInt(128, llvm::makeArrayRef(reinterpret_cast<const u64*>(v._bytes), 2)));
}
verify(HERE), t->isVectorTy() && llvm::cast<llvm::VectorType>(t)->getBitWidth() == 128; verify(HERE), t->isVectorTy() && llvm::cast<llvm::VectorType>(t)->getBitWidth() == 128;
const auto sct = t->getScalarType(); const auto sct = t->getScalarType();
+100 -20
View File
@@ -828,7 +828,7 @@ struct llvm_neg
static_assert(llvm_value_t<T>::is_sint || llvm_value_t<T>::is_uint || llvm_value_t<T>::is_float, "llvm_neg<>: invalid type"); static_assert(llvm_value_t<T>::is_sint || llvm_value_t<T>::is_uint || llvm_value_t<T>::is_float, "llvm_neg<>: invalid type");
static constexpr auto opc = llvm_value_t<T>::is_float ? llvm::Instruction::FSub : llvm::Instruction::Sub; static constexpr auto opc = llvm_value_t<T>::is_float ? llvm::Instruction::FNeg : llvm::Instruction::Sub;
llvm::Value* eval(llvm::IRBuilder<>* ir) const llvm::Value* eval(llvm::IRBuilder<>* ir) const
{ {
@@ -849,6 +849,19 @@ struct llvm_neg
{ {
llvm::Value* v1 = {}; llvm::Value* v1 = {};
if constexpr (llvm_value_t<T>::is_float)
{
if (auto i = llvm::dyn_cast_or_null<llvm::UnaryOperator>(value); i && i->getOpcode() == opc)
{
v1 = i->getOperand(0);
if (auto r1 = a1.match(v1); v1)
{
return r1;
}
}
}
if (auto i = llvm::dyn_cast_or_null<llvm::BinaryOperator>(value); i && i->getOpcode() == opc) if (auto i = llvm::dyn_cast_or_null<llvm::BinaryOperator>(value); i && i->getOpcode() == opc)
{ {
v1 = i->getOperand(1); v1 = i->getOperand(1);
@@ -996,8 +1009,8 @@ struct llvm_fshl
static llvm::Function* get_fshl(llvm::IRBuilder<>* ir) static llvm::Function* get_fshl(llvm::IRBuilder<>* ir)
{ {
const auto module = ir->GetInsertBlock()->getParent()->getParent(); const auto _module = ir->GetInsertBlock()->getParent()->getParent();
return llvm::Intrinsic::getDeclaration(module, llvm::Intrinsic::fshl, {llvm_value_t<T>::get_type(ir->getContext())}); return llvm::Intrinsic::getDeclaration(_module, llvm::Intrinsic::fshl, {llvm_value_t<T>::get_type(ir->getContext())});
} }
static llvm::Value* fold(llvm::IRBuilder<>* ir, llvm::Value* v1, llvm::Value* v2, llvm::Value* v3) static llvm::Value* fold(llvm::IRBuilder<>* ir, llvm::Value* v1, llvm::Value* v2, llvm::Value* v3)
@@ -1068,8 +1081,8 @@ struct llvm_fshr
static llvm::Function* get_fshr(llvm::IRBuilder<>* ir) static llvm::Function* get_fshr(llvm::IRBuilder<>* ir)
{ {
const auto module = ir->GetInsertBlock()->getParent()->getParent(); const auto _module = ir->GetInsertBlock()->getParent()->getParent();
return llvm::Intrinsic::getDeclaration(module, llvm::Intrinsic::fshr, {llvm_value_t<T>::get_type(ir->getContext())}); return llvm::Intrinsic::getDeclaration(_module, llvm::Intrinsic::fshr, {llvm_value_t<T>::get_type(ir->getContext())});
} }
static llvm::Value* fold(llvm::IRBuilder<>* ir, llvm::Value* v1, llvm::Value* v2, llvm::Value* v3) static llvm::Value* fold(llvm::IRBuilder<>* ir, llvm::Value* v1, llvm::Value* v2, llvm::Value* v3)
@@ -1629,7 +1642,7 @@ struct llvm_bitcast
using type = U; using type = U;
llvm_expr_t<A1> a1; llvm_expr_t<A1> a1;
llvm::Module* module; llvm::Module* _module;
static constexpr uint bitsize0 = llvm_value_t<T>::is_vector ? llvm_value_t<T>::is_vector * llvm_value_t<T>::esize : llvm_value_t<T>::esize; static constexpr uint bitsize0 = llvm_value_t<T>::is_vector ? llvm_value_t<T>::is_vector * llvm_value_t<T>::esize : llvm_value_t<T>::esize;
static constexpr uint bitsize1 = llvm_value_t<U>::is_vector ? llvm_value_t<U>::is_vector * llvm_value_t<U>::esize : llvm_value_t<U>::esize; static constexpr uint bitsize1 = llvm_value_t<U>::is_vector ? llvm_value_t<U>::is_vector * llvm_value_t<U>::esize : llvm_value_t<U>::esize;
@@ -1655,7 +1668,7 @@ struct llvm_bitcast
if (const auto c1 = llvm::dyn_cast<llvm::Constant>(v1)) if (const auto c1 = llvm::dyn_cast<llvm::Constant>(v1))
{ {
const auto result = llvm::ConstantFoldCastOperand(llvm::Instruction::BitCast, c1, rt, module->getDataLayout()); const auto result = llvm::ConstantFoldCastOperand(llvm::Instruction::BitCast, c1, rt, _module->getDataLayout());
if (result) if (result)
{ {
@@ -1701,7 +1714,7 @@ struct llvm_bitcast
const auto target = llvm_value_t<T>::get_type(c->getContext()); const auto target = llvm_value_t<T>::get_type(c->getContext());
// Reverse bitcast on a constant // Reverse bitcast on a constant
if (llvm::Value* cv = llvm::ConstantFoldCastOperand(llvm::Instruction::BitCast, c, target, module->getDataLayout())) if (llvm::Value* cv = llvm::ConstantFoldCastOperand(llvm::Instruction::BitCast, c, target, _module->getDataLayout()))
{ {
if (auto r1 = a1.match(cv); cv) if (auto r1 = a1.match(cv); cv)
{ {
@@ -2016,8 +2029,8 @@ struct llvm_add_sat
static llvm::Function* get_add_sat(llvm::IRBuilder<>* ir) static llvm::Function* get_add_sat(llvm::IRBuilder<>* ir)
{ {
const auto module = ir->GetInsertBlock()->getParent()->getParent(); const auto _module = ir->GetInsertBlock()->getParent()->getParent();
return llvm::Intrinsic::getDeclaration(module, intr, {llvm_value_t<T>::get_type(ir->getContext())}); return llvm::Intrinsic::getDeclaration(_module, intr, {llvm_value_t<T>::get_type(ir->getContext())});
} }
llvm::Value* eval(llvm::IRBuilder<>* ir) const llvm::Value* eval(llvm::IRBuilder<>* ir) const
@@ -2087,8 +2100,8 @@ struct llvm_sub_sat
static llvm::Function* get_sub_sat(llvm::IRBuilder<>* ir) static llvm::Function* get_sub_sat(llvm::IRBuilder<>* ir)
{ {
const auto module = ir->GetInsertBlock()->getParent()->getParent(); const auto _module = ir->GetInsertBlock()->getParent()->getParent();
return llvm::Intrinsic::getDeclaration(module, intr, {llvm_value_t<T>::get_type(ir->getContext())}); return llvm::Intrinsic::getDeclaration(_module, intr, {llvm_value_t<T>::get_type(ir->getContext())});
} }
llvm::Value* eval(llvm::IRBuilder<>* ir) const llvm::Value* eval(llvm::IRBuilder<>* ir) const
@@ -2390,7 +2403,7 @@ struct llvm_shuffle2
class cpu_translator class cpu_translator
{ {
protected: protected:
cpu_translator(llvm::Module* module, bool is_be); cpu_translator(llvm::Module* _module, bool is_be);
// LLVM context // LLVM context
std::reference_wrapper<llvm::LLVMContext> m_context; std::reference_wrapper<llvm::LLVMContext> m_context;
@@ -2410,6 +2423,9 @@ protected:
// Allow FMA // Allow FMA
bool m_use_fma = false; bool m_use_fma = false;
// Allow Icelake tier AVX-512
bool m_use_avx512_icl = false;
// IR builder // IR builder
llvm::IRBuilder<>* m_ir; llvm::IRBuilder<>* m_ir;
@@ -2682,8 +2698,8 @@ public:
template <typename... Types> template <typename... Types>
llvm::Function* get_intrinsic(llvm::Intrinsic::ID id) llvm::Function* get_intrinsic(llvm::Intrinsic::ID id)
{ {
const auto module = m_ir->GetInsertBlock()->getParent()->getParent(); const auto _module = m_ir->GetInsertBlock()->getParent()->getParent();
return llvm::Intrinsic::getDeclaration(module, id, {get_type<Types>()...}); return llvm::Intrinsic::getDeclaration(_module, id, {get_type<Types>()...});
} }
template <typename T> template <typename T>
@@ -2731,22 +2747,86 @@ public:
} }
// TODO: Support doubles // TODO: Support doubles
auto fre(value_t<f32[4]> a) template <typename T, typename = std::enable_if_t<llvm_value_t<typename T::type>::esize == 32u && llvm_value_t<typename T::type>::is_float>>
auto fre(T a)
{ {
decltype(a) result; value_t<typename T::type> result;
const auto av = a.eval(m_ir); const auto av = a.eval(m_ir);
result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.rcp.ps", av->getType(), av->getType()).getCallee(), {av}); result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.rcp.ps", av->getType(), av->getType()).getCallee(), {av});
return result; return result;
} }
auto frsqe(value_t<f32[4]> a) template <typename T, typename = std::enable_if_t<llvm_value_t<typename T::type>::esize == 32u && llvm_value_t<typename T::type>::is_float>>
auto frsqe(T a)
{ {
decltype(a) result; value_t<typename T::type> result;
const auto av = a.eval(m_ir); const auto av = a.eval(m_ir);
result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.rsqrt.ps", av->getType(), av->getType()).getCallee(), {av}); result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.rsqrt.ps", av->getType(), av->getType()).getCallee(), {av});
return result; return result;
} }
template <typename T, typename U, typename = std::enable_if_t<std::is_same_v<typename T::type, typename U::type> && llvm_value_t<typename T::type>::esize == 32u && llvm_value_t<typename T::type>::is_float>>
auto fmax(T a, U b)
{
value_t<typename T::type> result;
const auto av = a.eval(m_ir);
const auto bv = b.eval(m_ir);
result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.max.ps", av->getType(), av->getType(), av->getType()).getCallee(), {av, bv});
return result;
}
template <typename T, typename U, typename = std::enable_if_t<std::is_same_v<typename T::type, typename U::type> && llvm_value_t<typename T::type>::esize == 32u && llvm_value_t<typename T::type>::is_float>>
auto fmin(T a, U b)
{
value_t<typename T::type> result;
const auto av = a.eval(m_ir);
const auto bv = b.eval(m_ir);
result.value = m_ir->CreateCall(m_module->getOrInsertFunction("llvm.x86.sse.min.ps", av->getType(), av->getType(), av->getType()).getCallee(), {av, bv});
return result;
}
template <typename T1, typename T2>
value_t<u8[16]> gf2p8affineqb(T1 a, T2 b, u8 c)
{
value_t<u8[16]> result;
const auto data0 = a.eval(m_ir);
const auto data1 = b.eval(m_ir);
const auto immediate = (llvm_const_int<u8>{c});
const auto imm8 = immediate.eval(m_ir);
result.value = m_ir->CreateCall(get_intrinsic(llvm::Intrinsic::x86_vgf2p8affineqb_128), {data0, data1, imm8});
return result;
}
template <typename T1, typename T2, typename T3>
value_t<u8[16]> vperm2b(T1 a, T2 b, T3 c)
{
value_t<u8[16]> result;
const auto data0 = a.eval(m_ir);
const auto data1 = b.eval(m_ir);
const auto index = c.eval(m_ir);
const auto zeros = llvm::ConstantAggregateZero::get(get_type<u8[16]>());
if (auto c = llvm::dyn_cast<llvm::Constant>(index))
{
// Convert VPERM2B index back to LLVM vector shuffle mask
const auto cv = llvm::dyn_cast<llvm::ConstantDataVector>(c);
if (cv || llvm::isa<llvm::ConstantAggregateZero>(c))
{
result.value = m_ir->CreateZExt(cv, get_type<u32[16]>());
result.value = m_ir->CreateShuffleVector(data0, data1, result.value);
return result;
}
}
result.value = m_ir->CreateCall(get_intrinsic(llvm::Intrinsic::x86_avx512_vpermi2var_qi_128), {data0, index, data1});
return result;
}
template <typename T1, typename T2> template <typename T1, typename T2>
value_t<u8[16]> pshufb(T1 a, T2 b) value_t<u8[16]> pshufb(T1 a, T2 b)
{ {
@@ -2824,7 +2904,7 @@ public:
} }
template <typename R = v128> template <typename R = v128>
R get_const_vector(llvm::Constant*, u32 a, u32 b); std::pair<bool, R> get_const_vector(llvm::Value*, u32 a, u32 b);
template <typename T = v128> template <typename T = v128>
llvm::Constant* make_const_vector(T, llvm::Type*); llvm::Constant* make_const_vector(T, llvm::Type*);
+6
View File
@@ -45,6 +45,12 @@ void fmt_class_string<MFC>::format(std::string& out, u64 arg)
case MFC_EIEIO_CMD: return "EIEIO"; case MFC_EIEIO_CMD: return "EIEIO";
case MFC_SYNC_CMD: return "SYNC"; case MFC_SYNC_CMD: return "SYNC";
case MFC_SDCRT_CMD: return "SDCRT";
case MFC_SDCRTST_CMD: return "SDCRTST";
case MFC_SDCRZ_CMD: return "SDCRZ";
case MFC_SDCRS_CMD: return "SDCRS";
case MFC_SDCRF_CMD: return "SDCRF";
case MFC_BARRIER_MASK: case MFC_BARRIER_MASK:
case MFC_FENCE_MASK: case MFC_FENCE_MASK:
case MFC_LIST_MASK: case MFC_LIST_MASK:
+8 -2
View File
@@ -27,10 +27,16 @@ enum MFC : u8
MFC_LIST_MASK = 0x04, MFC_LIST_MASK = 0x04,
MFC_START_MASK = 0x08, MFC_START_MASK = 0x08,
MFC_RESULT_MASK = 0x10, // ??? MFC_RESULT_MASK = 0x10, // ???
MFC_SDCRT_CMD = 0x80,
MFC_SDCRTST_CMD = 0x81,
MFC_SDCRZ_CMD = 0x89,
MFC_SDCRS_CMD = 0x8D,
MFC_SDCRF_CMD = 0x8F,
}; };
// Atomic Status Update // Atomic Status Update
enum : u32 enum mfc_atomic_status : u32
{ {
MFC_PUTLLC_SUCCESS = 0, MFC_PUTLLC_SUCCESS = 0,
MFC_PUTLLC_FAILURE = 1, // reservation was lost MFC_PUTLLC_FAILURE = 1, // reservation was lost
@@ -39,7 +45,7 @@ enum : u32
}; };
// MFC Write Tag Status Update Request Channel (ch23) operations // MFC Write Tag Status Update Request Channel (ch23) operations
enum : u32 enum mfc_tag_update : u32
{ {
MFC_TAG_UPDATE_IMMEDIATE = 0, MFC_TAG_UPDATE_IMMEDIATE = 0,
MFC_TAG_UPDATE_ANY = 1, MFC_TAG_UPDATE_ANY = 1,
+3 -3
View File
@@ -83,7 +83,7 @@ bool statichle_handler::load_patterns()
dapat.crc16_length = ::narrow<u8>(char_to_u8(pattern[1][0], pattern[1][1]), HERE); dapat.crc16_length = ::narrow<u8>(char_to_u8(pattern[1][0], pattern[1][1]), HERE);
dapat.crc16 = (char_to_u8(pattern[2][0], pattern[2][1]) << 8) | char_to_u8(pattern[2][2], pattern[2][3]); dapat.crc16 = (char_to_u8(pattern[2][0], pattern[2][1]) << 8) | char_to_u8(pattern[2][2], pattern[2][3]);
dapat.total_length = (char_to_u8(pattern[3][0], pattern[3][1]) << 8) | char_to_u8(pattern[3][2], pattern[3][3]); dapat.total_length = (char_to_u8(pattern[3][0], pattern[3][1]) << 8) | char_to_u8(pattern[3][2], pattern[3][3]);
dapat.module = pattern[4]; dapat._module = pattern[4];
dapat.name = pattern[5]; dapat.name = pattern[5];
dapat.fnid = ppu_generate_id(dapat.name.c_str()); dapat.fnid = ppu_generate_id(dapat.name.c_str());
@@ -153,11 +153,11 @@ bool statichle_handler::check_against_patterns(vm::cptr<u8>& data, u32 size, u32
static_hle.success("Found function %s at 0x%x", pat.name, addr); static_hle.success("Found function %s at 0x%x", pat.name, addr);
// patch the code // patch the code
const auto smodule = ppu_module_manager::get_module(pat.module); const auto smodule = ppu_module_manager::get_module(pat._module);
if (smodule == nullptr) if (smodule == nullptr)
{ {
static_hle.error("Couldn't find module: %s", pat.module); static_hle.error("Couldn't find module: %s", pat._module);
return false; return false;
} }
+1 -1
View File
@@ -11,7 +11,7 @@ struct shle_pattern
u8 crc16_length; u8 crc16_length;
u16 crc16; u16 crc16;
u16 total_length; u16 total_length;
std::string module; std::string _module;
std::string name; std::string name;
u32 fnid; u32 fnid;
+270 -79
View File
@@ -44,8 +44,43 @@ void fmt_class_string<CellAudioError>::format(std::string& out, u64 arg)
cell_audio_config::cell_audio_config() cell_audio_config::cell_audio_config()
{ {
raw = audio::get_raw_config();
reset();
}
void cell_audio_config::reset()
{
backend.reset();
backend = Emu.GetCallbacks().get_audio();
audio_channels = backend->get_channels();
audio_sampling_rate = backend->get_sampling_rate();
audio_block_period = AUDIO_BUFFER_SAMPLES * 1000000 / audio_sampling_rate;
audio_buffer_length = AUDIO_BUFFER_SAMPLES * audio_channels;
audio_buffer_size = audio_buffer_length * backend->get_sample_size();
desired_buffer_duration = raw.desired_buffer_duration * 1000llu;
buffering_enabled = raw.buffering_enabled && backend->has_capability(AudioBackend::PLAY_PAUSE_FLUSH | AudioBackend::IS_PLAYING);;
minimum_block_period = audio_block_period / 2;
maximum_block_period = (6 * audio_block_period) / 5;
desired_full_buffers = buffering_enabled ? static_cast<u32>(desired_buffer_duration / audio_block_period) + 3 : 2;
num_allocated_buffers = desired_full_buffers + EXTRA_AUDIO_BUFFERS;
fully_untouched_timeout = static_cast<u64>(audio_block_period) * 2;
partially_untouched_timeout = static_cast<u64>(audio_block_period) * 4;
const bool raw_time_stretching_enabled = buffering_enabled && raw.enable_time_stretching && (raw.time_stretching_threshold > 0);
time_stretching_enabled = raw_time_stretching_enabled && backend->has_capability(AudioBackend::SET_FREQUENCY_RATIO);
time_stretching_threshold = raw.time_stretching_threshold / 100.0f;
// Warn if audio backend does not support all requested features // Warn if audio backend does not support all requested features
if (raw_buffering_enabled && !buffering_enabled) if (raw.buffering_enabled && !buffering_enabled)
{ {
cellAudio.error("Audio backend %s does not support buffering, this option will be ignored.", backend->GetName()); cellAudio.error("Audio backend %s does not support buffering, this option will be ignored.", backend->GetName());
} }
@@ -142,7 +177,7 @@ void audio_ringbuffer::enqueue(const float* in_buffer)
} }
// Enqueue audio // Enqueue audio
bool success = backend->AddData(buf, AUDIO_BUFFER_SAMPLES * cfg.audio_channels); const bool success = backend->AddData(buf, AUDIO_BUFFER_SAMPLES * cfg.audio_channels);
if (!success) if (!success)
{ {
cellAudio.error("Could not enqueue buffer onto audio backend. Attempting to recover..."); cellAudio.error("Could not enqueue buffer onto audio backend. Attempting to recover...");
@@ -311,8 +346,8 @@ void audio_port::tag(s32 offset)
// We use -0.0f in case games check if the buffer is empty. -0.0f == 0.0f evaluates to true, but std::signbit can be used to distinguish them // We use -0.0f in case games check if the buffer is empty. -0.0f == 0.0f evaluates to true, but std::signbit can be used to distinguish them
const f32 tag = -0.0f; const f32 tag = -0.0f;
const u32 tag_first_pos = num_channels == 2 ? PORT_BUFFER_TAG_FIRST_2CH : PORT_BUFFER_TAG_FIRST_8CH; const u32 tag_first_pos = num_channels == 2 ? PORT_BUFFER_TAG_FIRST_2CH : num_channels == 6 ? PORT_BUFFER_TAG_FIRST_6CH : PORT_BUFFER_TAG_FIRST_8CH;
const u32 tag_delta = num_channels == 2 ? PORT_BUFFER_TAG_DELTA_2CH : PORT_BUFFER_TAG_DELTA_8CH; const u32 tag_delta = num_channels == 2 ? PORT_BUFFER_TAG_DELTA_2CH : num_channels == 6 ? PORT_BUFFER_TAG_DELTA_6CH : PORT_BUFFER_TAG_DELTA_8CH;
for (u32 tag_pos = tag_first_pos, tag_nr = 0; tag_nr < PORT_BUFFER_TAG_COUNT; tag_pos += tag_delta, tag_nr++) for (u32 tag_pos = tag_first_pos, tag_nr = 0; tag_nr < PORT_BUFFER_TAG_COUNT; tag_pos += tag_delta, tag_nr++)
{ {
@@ -341,8 +376,8 @@ std::tuple<u32, u32, u32, u32> cell_audio_thread::count_port_buffer_tags()
u32 port_pos = port.position(); u32 port_pos = port.position();
// Find the last tag that has been touched // Find the last tag that has been touched
const u32 tag_first_pos = port.num_channels == 2 ? PORT_BUFFER_TAG_FIRST_2CH : PORT_BUFFER_TAG_FIRST_8CH; const u32 tag_first_pos = port.num_channels == 2 ? PORT_BUFFER_TAG_FIRST_2CH : port.num_channels == 6 ? PORT_BUFFER_TAG_FIRST_6CH : PORT_BUFFER_TAG_FIRST_8CH;
const u32 tag_delta = port.num_channels == 2 ? PORT_BUFFER_TAG_DELTA_2CH : PORT_BUFFER_TAG_DELTA_8CH; const u32 tag_delta = port.num_channels == 2 ? PORT_BUFFER_TAG_DELTA_2CH : port.num_channels == 6 ? PORT_BUFFER_TAG_DELTA_6CH : PORT_BUFFER_TAG_DELTA_8CH;
u32 last_touched_tag_nr = port.prev_touched_tag_nr; u32 last_touched_tag_nr = port.prev_touched_tag_nr;
bool retouched = false; bool retouched = false;
@@ -460,13 +495,13 @@ void cell_audio_thread::advance(u64 timestamp, bool reset)
for (const auto& key_inf : keys) for (const auto& key_inf : keys)
{ {
if (const auto queue = lv2_event_queue::find(key_inf.key)) if (key_inf.flags & CELL_AUDIO_EVENTFLAG_NOMIX)
{ {
if (key_inf.flags & CELL_AUDIO_EVENTFLAG_NOMIX) continue;
{ }
continue;
}
if ((queues[queue_count] = key_inf.port.lock()))
{
u32 periods = 1; u32 periods = 1;
if (key_inf.flags & CELL_AUDIO_EVENTFLAG_DECIMATE_2) if (key_inf.flags & CELL_AUDIO_EVENTFLAG_DECIMATE_2)
@@ -483,11 +518,12 @@ void cell_audio_thread::advance(u64 timestamp, bool reset)
if ((event_period ^ key_inf.start_period) & (periods - 1)) if ((event_period ^ key_inf.start_period) & (periods - 1))
{ {
// The time has not come for this key to receive event // The time has not come for this key to receive event
queues[queue_count].reset();
continue; continue;
} }
event_sources[queue_count] = key_inf.source; event_sources[queue_count] = key_inf.source;
queues[queue_count++] = queue; queue_count++;
} }
} }
@@ -499,6 +535,63 @@ void cell_audio_thread::advance(u64 timestamp, bool reset)
} }
} }
namespace audio
{
cell_audio_config::raw_config get_raw_config()
{
return
{
.buffering_enabled = static_cast<bool>(g_cfg.audio.enable_buffering),
.desired_buffer_duration = g_cfg.audio.desired_buffer_duration,
.enable_time_stretching = static_cast<bool>(g_cfg.audio.enable_time_stretching),
.time_stretching_threshold = g_cfg.audio.time_stretching_threshold,
.convert_to_u16 = static_cast<bool>(g_cfg.audio.convert_to_u16),
.start_threshold = static_cast<u32>(g_cfg.audio.start_threshold),
.sampling_period_multiplier = static_cast<u32>(g_cfg.audio.sampling_period_multiplier),
.downmix = g_cfg.audio.audio_channel_downmix,
.renderer = g_cfg.audio.renderer
};
}
void configure_audio()
{
if (const auto g_audio = g_fxo->get<cell_audio>())
{
// Only reboot the audio renderer if a relevant setting changed
const auto new_raw = get_raw_config();
if (const auto raw = g_audio->cfg.raw;
raw.desired_buffer_duration != new_raw.desired_buffer_duration ||
raw.buffering_enabled != new_raw.buffering_enabled ||
raw.time_stretching_threshold != new_raw.time_stretching_threshold ||
raw.enable_time_stretching != new_raw.enable_time_stretching ||
raw.convert_to_u16 != new_raw.convert_to_u16 ||
raw.start_threshold != new_raw.start_threshold ||
raw.sampling_period_multiplier != new_raw.sampling_period_multiplier ||
raw.downmix != new_raw.downmix ||
raw.renderer != new_raw.renderer)
{
g_audio->cfg.raw = new_raw;
g_audio->m_update_configuration = true;
}
}
}
}
void cell_audio_thread::update_config()
{
std::lock_guard lock(mutex);
// Clear ringbuffer
ringbuffer.reset();
// Reload config
cfg.reset();
// Allocate ringbuffer
ringbuffer.reset(new audio_ringbuffer(cfg));
}
void cell_audio_thread::operator()() void cell_audio_thread::operator()()
{ {
thread_ctrl::set_native_priority(1); thread_ctrl::set_native_priority(1);
@@ -518,6 +611,12 @@ void cell_audio_thread::operator()()
// Main cellAudio loop // Main cellAudio loop
while (thread_ctrl::state() != thread_state::aborting) while (thread_ctrl::state() != thread_state::aborting)
{ {
if (m_update_configuration)
{
update_config();
m_update_configuration = false;
}
const u64 timestamp = ringbuffer->update(); const u64 timestamp = ringbuffer->update();
if (Emu.IsPaused()) if (Emu.IsPaused())
@@ -741,16 +840,19 @@ void cell_audio_thread::operator()()
// Mix // Mix
float *buf = ringbuffer->get_current_buffer(); float *buf = ringbuffer->get_current_buffer();
if (cfg.audio_channels == 2)
{ switch (cfg.audio_channels)
mix<true>(buf);
}
else if (cfg.audio_channels == 8)
{
mix<false>(buf);
}
else
{ {
case 2:
mix<audio_downmix::downmix_to_stereo>(buf);
break;
case 6:
mix<audio_downmix::downmix_to_5_1>(buf);
break;
case 8:
mix<audio_downmix::no_downmix>(buf);
break;
default:
fmt::throw_exception("Unsupported number of audio channels: %u", cfg.audio_channels); fmt::throw_exception("Unsupported number of audio channels: %u", cfg.audio_channels);
} }
@@ -765,16 +867,18 @@ void cell_audio_thread::operator()()
ringbuffer.reset(); ringbuffer.reset();
} }
template <bool DownmixToStereo> template <audio_downmix downmix>
void cell_audio_thread::mix(float *out_buffer, s32 offset) void cell_audio_thread::mix(float *out_buffer, s32 offset)
{ {
AUDIT(out_buffer != nullptr); AUDIT(out_buffer != nullptr);
constexpr u32 channels = DownmixToStereo ? 2 : 8; constexpr u32 channels = downmix == audio_downmix::no_downmix ? 8 : downmix == audio_downmix::downmix_to_5_1 ? 6 : 2;
constexpr u32 out_buffer_sz = channels * AUDIO_BUFFER_SAMPLES; constexpr u32 out_buffer_sz = channels * AUDIO_BUFFER_SAMPLES;
bool first_mix = true; bool first_mix = true;
const float master_volume = g_cfg.audio.volume / 100.0f;
// mixing // mixing
for (auto& port : ports) for (auto& port : ports)
{ {
@@ -782,13 +886,12 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
auto buf = port.get_vm_ptr(offset); auto buf = port.get_vm_ptr(offset);
static const float k = 1.f; static const float k = 1.f;
static const float minus_3db = 0.707f; /* value taken from static constexpr float minus_3db = 0.707f; // value taken from https://www.dolby.com/us/en/technologies/a-guide-to-dolby-metadata.pdf
https://www.dolby.com/us/en/technologies/a-guide-to-dolby-metadata.pdf */ float m = master_volume;
float& m = port.level;
// part of cellAudioSetPortLevel functionality // part of cellAudioSetPortLevel functionality
// spread port volume changes over 13ms // spread port volume changes over 13ms
auto step_volume = [](audio_port& port) auto step_volume = [master_volume, &m](audio_port& port)
{ {
const auto param = port.level_set.load(); const auto param = port.level_set.load();
@@ -803,6 +906,8 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
port.level_set.compare_and_swap(param, { param.value, 0.0f }); port.level_set.compare_and_swap(param, { param.value, 0.0f });
} }
} }
m = port.level * master_volume;
}; };
if (port.num_channels == 2) if (port.num_channels == 2)
@@ -819,14 +924,18 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
out_buffer[out + 0] = left; out_buffer[out + 0] = left;
out_buffer[out + 1] = right; out_buffer[out + 1] = right;
if constexpr (!DownmixToStereo) if constexpr (downmix != audio_downmix::downmix_to_stereo)
{ {
out_buffer[out + 2] = 0.0f; out_buffer[out + 2] = 0.0f;
out_buffer[out + 3] = 0.0f; out_buffer[out + 3] = 0.0f;
out_buffer[out + 4] = 0.0f; out_buffer[out + 4] = 0.0f;
out_buffer[out + 5] = 0.0f; out_buffer[out + 5] = 0.0f;
out_buffer[out + 6] = 0.0f;
out_buffer[out + 7] = 0.0f; if constexpr (downmix != audio_downmix::downmix_to_5_1)
{
out_buffer[out + 6] = 0.0f;
out_buffer[out + 7] = 0.0f;
}
} }
} }
first_mix = false; first_mix = false;
@@ -862,12 +971,21 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
const float side_left = buf[in + 6] * m; const float side_left = buf[in + 6] * m;
const float side_right = buf[in + 7] * m; const float side_right = buf[in + 7] * m;
if constexpr (DownmixToStereo) if constexpr (downmix == audio_downmix::downmix_to_stereo)
{ {
const float mid = center * minus_3db; /* don't mix in the lfe as per // Don't mix in the lfe as per dolby specification and based on documentation
dolby specification */ const float mid = center * 0.5f;
out_buffer[out + 0] = (left + rear_left + (side_left * minus_3db) + mid) * k; out_buffer[out + 0] = left * minus_3db + mid + side_left * 0.5f + rear_left * 0.5f;
out_buffer[out + 1] = (right + rear_right + (side_right * minus_3db) + mid) * k; out_buffer[out + 1] = right * minus_3db + mid + side_right * 0.5f + rear_right * 0.5f;
}
else if constexpr (downmix == audio_downmix::downmix_to_5_1)
{
out_buffer[out + 0] = left;
out_buffer[out + 1] = right;
out_buffer[out + 2] = center;
out_buffer[out + 3] = low_freq;
out_buffer[out + 4] = side_left + rear_left;
out_buffer[out + 5] = side_right + rear_right;
} }
else else
{ {
@@ -898,11 +1016,21 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
const float side_left = buf[in + 6] * m; const float side_left = buf[in + 6] * m;
const float side_right = buf[in + 7] * m; const float side_right = buf[in + 7] * m;
if constexpr (DownmixToStereo) if constexpr (downmix == audio_downmix::downmix_to_stereo)
{ {
const float mid = center * minus_3db; // Don't mix in the lfe as per dolby specification and based on documentation
out_buffer[out + 0] += (left + rear_left + (side_left * minus_3db) + mid) * k; const float mid = center * 0.5f;
out_buffer[out + 1] += (right + rear_right + (side_right * minus_3db) + mid) * k; out_buffer[out + 0] += left * minus_3db + mid + side_left * 0.5f + rear_left * 0.5f;
out_buffer[out + 1] += right * minus_3db + mid + side_right * 0.5f + rear_right * 0.5f;
}
else if constexpr (downmix == audio_downmix::downmix_to_5_1)
{
out_buffer[out + 0] += left;
out_buffer[out + 1] += right;
out_buffer[out + 2] += center;
out_buffer[out + 3] += low_freq;
out_buffer[out + 4] += side_left + rear_left;
out_buffer[out + 5] += side_right + rear_right;
} }
else else
{ {
@@ -929,7 +1057,7 @@ void cell_audio_thread::mix(float *out_buffer, s32 offset)
{ {
std::memset(out_buffer, 0, out_buffer_sz * sizeof(float)); std::memset(out_buffer, 0, out_buffer_sz * sizeof(float));
} }
else if (g_cfg.audio.convert_to_u16) else if (cfg.backend->get_convert_to_u16())
{ {
// convert the data from float to u16 with clipping: // convert the data from float to u16 with clipping:
// 2x MULPS // 2x MULPS
@@ -1037,16 +1165,16 @@ error_code cellAudioPortOpen(vm::ptr<CellAudioPortParam> audioParam, vm::ptr<u32
// check attributes // check attributes
if (num_channels != CELL_AUDIO_PORT_2CH && if (num_channels != CELL_AUDIO_PORT_2CH &&
num_channels != CELL_AUDIO_PORT_8CH && num_channels != CELL_AUDIO_PORT_8CH &&
num_channels) num_channels != 0)
{ {
return CELL_AUDIO_ERROR_PARAM; return CELL_AUDIO_ERROR_PARAM;
} }
if (num_blocks != CELL_AUDIO_BLOCK_8 && if (num_blocks != 2 &&
num_blocks != CELL_AUDIO_BLOCK_16 &&
num_blocks != 2 &&
num_blocks != 4 && num_blocks != 4 &&
num_blocks != 32) num_blocks != CELL_AUDIO_BLOCK_8 &&
num_blocks != CELL_AUDIO_BLOCK_16 &&
num_blocks != CELL_AUDIO_BLOCK_32)
{ {
return CELL_AUDIO_ERROR_PARAM; return CELL_AUDIO_ERROR_PARAM;
} }
@@ -1092,6 +1220,9 @@ error_code cellAudioPortOpen(vm::ptr<CellAudioPortParam> audioParam, vm::ptr<u32
{ {
return CELL_AUDIO_ERROR_PORT_FULL; return CELL_AUDIO_ERROR_PORT_FULL;
} }
// TODO: is this necessary in any way? (Based on libaudio.prx)
//const u64 num_channels_non_0 = std::max<u64>(1, num_channels);
port->num_channels = ::narrow<u32>(num_channels); port->num_channels = ::narrow<u32>(num_channels);
port->num_blocks = ::narrow<u32>(num_blocks); port->num_blocks = ::narrow<u32>(num_blocks);
@@ -1104,15 +1235,20 @@ error_code cellAudioPortOpen(vm::ptr<CellAudioPortParam> audioParam, vm::ptr<u32
if (attr & CELL_AUDIO_PORTATTR_INITLEVEL) if (attr & CELL_AUDIO_PORTATTR_INITLEVEL)
{ {
port->level = audioParam->level * g_cfg.audio.volume / 100.0f; port->level = audioParam->level;
} }
else else
{ {
port->level = g_cfg.audio.volume / 100.0f; port->level = 1.0f;
} }
port->level_set.store({ port->level, 0.0f }); port->level_set.store({ port->level, 0.0f });
if (port->level <= -1.0f)
{
return CELL_AUDIO_ERROR_PORT_OPEN;
}
*portNum = port->number; *portNum = port->number;
return CELL_OK; return CELL_OK;
} }
@@ -1141,10 +1277,18 @@ error_code cellAudioGetPortConfig(u32 portNum, vm::ptr<CellAudioPortConfig> port
switch (auto state = port.state.load()) switch (auto state = port.state.load())
{ {
case audio_port_state::closed: portConfig->status = CELL_AUDIO_STATUS_CLOSE; break; case audio_port_state::closed:
case audio_port_state::opened: portConfig->status = CELL_AUDIO_STATUS_READY; break; portConfig->status = CELL_AUDIO_STATUS_CLOSE;
case audio_port_state::started: portConfig->status = CELL_AUDIO_STATUS_RUN; break; break;
default: fmt::throw_exception("Invalid port state (%d: %d)", portNum, static_cast<u32>(state)); case audio_port_state::opened:
portConfig->status = CELL_AUDIO_STATUS_READY;
break;
case audio_port_state::started:
portConfig->status = CELL_AUDIO_STATUS_RUN;
break;
default:
cellAudio.error("Invalid port state (%d: %d)", portNum, static_cast<u32>(state));
return CELL_AUDIO_ERROR_AUDIOSYSTEM;
} }
portConfig->nChannel = port.num_channels; portConfig->nChannel = port.num_channels;
@@ -1262,12 +1406,13 @@ error_code cellAudioGetPortTimestamp(u32 portNum, u64 tag, vm::ptr<u64> stamp)
if (port.global_counter < tag) if (port.global_counter < tag)
{ {
cellAudio.error("cellAudioGetPortTimestamp(portNum=%d, tag=0x%llx, stamp=*0x%x) -> CELL_AUDIO_ERROR_TAG_NOT_FOUND", portNum, tag, stamp);
return CELL_AUDIO_ERROR_TAG_NOT_FOUND; return CELL_AUDIO_ERROR_TAG_NOT_FOUND;
} }
u64 delta_tag = port.global_counter - tag; const u64 delta_tag = port.global_counter - tag;
u64 delta_tag_stamp = delta_tag * g_audio->cfg.audio_block_period; const u64 delta_tag_stamp = delta_tag * g_audio->cfg.audio_block_period;
// Apparently no error is returned if stamp is null
*stamp = port.timestamp - delta_tag_stamp; *stamp = port.timestamp - delta_tag_stamp;
return CELL_OK; return CELL_OK;
@@ -1303,6 +1448,7 @@ error_code cellAudioGetPortBlockTag(u32 portNum, u64 blockNo, vm::ptr<u64> tag)
return CELL_AUDIO_ERROR_PARAM; return CELL_AUDIO_ERROR_PARAM;
} }
// Apparently no error is returned if tag is null
*tag = port.global_counter + blockNo - port.cur_pos; *tag = port.global_counter + blockNo - port.cur_pos;
return CELL_OK; return CELL_OK;
@@ -1333,8 +1479,6 @@ error_code cellAudioSetPortLevel(u32 portNum, float level)
return CELL_AUDIO_ERROR_PORT_NOT_OPEN; return CELL_AUDIO_ERROR_PORT_NOT_OPEN;
} }
level *= g_cfg.audio.volume / 100.0f;
if (level >= 0.0f) if (level >= 0.0f)
{ {
port.level_set.exchange({ level, (port.level - level) / 624.0f }); port.level_set.exchange({ level, (port.level - level) / 624.0f });
@@ -1411,21 +1555,35 @@ error_code AudioSetNotifyEventQueue(u64 key, u32 iFlags)
return CELL_AUDIO_ERROR_NOT_INIT; return CELL_AUDIO_ERROR_NOT_INIT;
} }
if (!lv2_event_queue::find(key)) auto q = lv2_event_queue::find(key);
if (!q)
{ {
return CELL_AUDIO_ERROR_TRANS_EVENT; return CELL_AUDIO_ERROR_TRANS_EVENT;
} }
for (const auto& k : g_audio->keys) // check for duplicates for (auto i = g_audio->keys.cbegin(); i != g_audio->keys.cend();) // check for duplicates
{ {
if (k.key == key) auto port = i->port.lock();
if (port == q)
{ {
return CELL_AUDIO_ERROR_TRANS_EVENT; return CELL_AUDIO_ERROR_TRANS_EVENT;
} }
if (!lv2_event_queue::check(port))
{
// Cleanup, avoid cases where there are multiple ports with the same key
i = g_audio->keys.erase(i);
}
else
{
i++;
}
} }
// Set unique source associated with the key // Set unique source associated with the key
g_audio->keys.push_back({g_audio->event_period, iFlags, ((process_getpid() + u64{}) << 32) + lv2_event_port::id_base + (g_audio->key_count++ * lv2_event_port::id_step), key}); g_audio->keys.push_back({g_audio->event_period, iFlags, ((process_getpid() + u64{}) << 32) + lv2_event_port::id_base + (g_audio->key_count++ * lv2_event_port::id_step), std::move(q)});
g_audio->key_count %= lv2_event_port::id_count; g_audio->key_count %= lv2_event_port::id_count;
return CELL_OK; return CELL_OK;
@@ -1463,7 +1621,7 @@ error_code AudioRemoveNotifyEventQueue(u64 key, u32 iFlags)
for (auto i = g_audio->keys.cbegin(); i != g_audio->keys.cend(); i++) for (auto i = g_audio->keys.cbegin(); i != g_audio->keys.cend(); i++)
{ {
if (i->key == key) if ([&](auto port){ return lv2_event_queue::check(port) && port->key == key; }(i->port.lock()))
{ {
if (i->flags != iFlags) if (i->flags != iFlags)
{ {
@@ -1511,18 +1669,11 @@ error_code cellAudioAddData(u32 portNum, vm::ptr<float> src, u32 samples, float
return CELL_AUDIO_ERROR_NOT_INIT; return CELL_AUDIO_ERROR_NOT_INIT;
} }
if (portNum >= AUDIO_PORT_COUNT || !src || !src.aligned()) if (portNum >= AUDIO_PORT_COUNT || !src || !src.aligned() || samples != CELL_AUDIO_BLOCK_SAMPLES)
{ {
return CELL_AUDIO_ERROR_PARAM; return CELL_AUDIO_ERROR_PARAM;
} }
if (samples != 256)
{
// despite the docs, seems that only fixed value is supported
cellAudio.error("cellAudioAddData(): invalid samples value (%d)", samples);
return CELL_AUDIO_ERROR_PARAM;
}
const audio_port& port = g_audio->ports[portNum]; const audio_port& port = g_audio->ports[portNum];
const auto dst = port.get_vm_ptr(); const auto dst = port.get_vm_ptr();
@@ -1552,18 +1703,11 @@ error_code cellAudioAdd2chData(u32 portNum, vm::ptr<float> src, u32 samples, flo
return CELL_AUDIO_ERROR_NOT_INIT; return CELL_AUDIO_ERROR_NOT_INIT;
} }
if (portNum >= AUDIO_PORT_COUNT || !src || !src.aligned()) if (portNum >= AUDIO_PORT_COUNT || !src || !src.aligned() || samples != CELL_AUDIO_BLOCK_SAMPLES)
{ {
return CELL_AUDIO_ERROR_PARAM; return CELL_AUDIO_ERROR_PARAM;
} }
if (samples != 256)
{
// despite the docs, seems that only fixed value is supported
cellAudio.error("cellAudioAdd2chData(): invalid samples value (%d)", samples);
return CELL_AUDIO_ERROR_PARAM;
}
const audio_port& port = g_audio->ports[portNum]; const audio_port& port = g_audio->ports[portNum];
const auto dst = port.get_vm_ptr(); const auto dst = port.get_vm_ptr();
@@ -1642,7 +1786,7 @@ error_code cellAudioAdd6chData(u32 portNum, vm::ptr<float> src, float volume)
if (port.num_channels == 6) if (port.num_channels == 6)
{ {
for (u32 i = 0; i < 256; i++) for (u32 i = 0; i < CELL_AUDIO_BLOCK_SAMPLES; i++)
{ {
dst[i * 6 + 0] += src[i * 6 + 0] * volume; // mix L ch dst[i * 6 + 0] += src[i * 6 + 0] * volume; // mix L ch
dst[i * 6 + 1] += src[i * 6 + 1] * volume; // mix R ch dst[i * 6 + 1] += src[i * 6 + 1] * volume; // mix R ch
@@ -1654,7 +1798,7 @@ error_code cellAudioAdd6chData(u32 portNum, vm::ptr<float> src, float volume)
} }
else if (port.num_channels == 8) else if (port.num_channels == 8)
{ {
for (u32 i = 0; i < 256; i++) for (u32 i = 0; i < CELL_AUDIO_BLOCK_SAMPLES; i++)
{ {
dst[i * 8 + 0] += src[i * 6 + 0] * volume; // mix L ch dst[i * 8 + 0] += src[i * 6 + 0] * volume; // mix L ch
dst[i * 8 + 1] += src[i * 6 + 1] * volume; // mix R ch dst[i * 8 + 1] += src[i * 6 + 1] * volume; // mix R ch
@@ -1677,6 +1821,18 @@ error_code cellAudioAdd6chData(u32 portNum, vm::ptr<float> src, float volume)
error_code cellAudioMiscSetAccessoryVolume(u32 devNum, float volume) error_code cellAudioMiscSetAccessoryVolume(u32 devNum, float volume)
{ {
cellAudio.todo("cellAudioMiscSetAccessoryVolume(devNum=%d, volume=%f)", devNum, volume); cellAudio.todo("cellAudioMiscSetAccessoryVolume(devNum=%d, volume=%f)", devNum, volume);
const auto g_audio = g_fxo->get<cell_audio>();
std::unique_lock lock(g_audio->mutex);
if (!g_audio->init)
{
return CELL_AUDIO_ERROR_NOT_INIT;
}
// TODO
return CELL_OK; return CELL_OK;
} }
@@ -1689,12 +1845,47 @@ error_code cellAudioSendAck(u64 data3)
error_code cellAudioSetPersonalDevice(s32 iPersonalStream, s32 iDevice) error_code cellAudioSetPersonalDevice(s32 iPersonalStream, s32 iDevice)
{ {
cellAudio.todo("cellAudioSetPersonalDevice(iPersonalStream=%d, iDevice=%d)", iPersonalStream, iDevice); cellAudio.todo("cellAudioSetPersonalDevice(iPersonalStream=%d, iDevice=%d)", iPersonalStream, iDevice);
const auto g_audio = g_fxo->get<cell_audio>();
std::unique_lock lock(g_audio->mutex);
if (!g_audio->init)
{
return CELL_AUDIO_ERROR_NOT_INIT;
}
if (iPersonalStream < 0 || iPersonalStream >= 4 ||
(iDevice != CELL_AUDIO_PERSONAL_DEVICE_PRIMARY && (iDevice < 0 || iDevice >= 5)))
{
return CELL_AUDIO_ERROR_PARAM;
}
// TODO
return CELL_OK; return CELL_OK;
} }
error_code cellAudioUnsetPersonalDevice(s32 iPersonalStream) error_code cellAudioUnsetPersonalDevice(s32 iPersonalStream)
{ {
cellAudio.todo("cellAudioUnsetPersonalDevice(iPersonalStream=%d)", iPersonalStream); cellAudio.todo("cellAudioUnsetPersonalDevice(iPersonalStream=%d)", iPersonalStream);
const auto g_audio = g_fxo->get<cell_audio>();
std::unique_lock lock(g_audio->mutex);
if (!g_audio->init)
{
return CELL_AUDIO_ERROR_NOT_INIT;
}
if (iPersonalStream < 0 || iPersonalStream >= 4)
{
return CELL_AUDIO_ERROR_PARAM;
}
// TODO
return CELL_OK; return CELL_OK;
} }
+69 -28
View File
@@ -6,6 +6,8 @@
#include "Emu/Audio/AudioBackend.h" #include "Emu/Audio/AudioBackend.h"
#include "Emu/Audio/AudioDumper.h" #include "Emu/Audio/AudioDumper.h"
struct lv2_event_queue;
// Error codes // Error codes
enum CellAudioError : u32 enum CellAudioError : u32
{ {
@@ -29,23 +31,31 @@ enum CellAudioError : u32
// constants // constants
enum enum
{ {
CELL_AUDIO_BLOCK_16 = 16,
CELL_AUDIO_BLOCK_8 = 8, CELL_AUDIO_BLOCK_8 = 8,
CELL_AUDIO_BLOCK_16 = 16,
CELL_AUDIO_BLOCK_32 = 32,
CELL_AUDIO_BLOCK_SAMPLES = 256, CELL_AUDIO_BLOCK_SAMPLES = 256,
CELL_AUDIO_CREATEEVENTFLAG_SPU = 0x00000001, CELL_AUDIO_CREATEEVENTFLAG_SPU = 0x00000001,
CELL_AUDIO_EVENT_HEADPHONE = 1,
CELL_AUDIO_EVENT_MIX = 0, CELL_AUDIO_EVENT_MIX = 0,
CELL_AUDIO_EVENT_HEADPHONE = 1,
CELL_AUDIO_EVENTFLAG_BEFOREMIX = 0x80000000, CELL_AUDIO_EVENTFLAG_BEFOREMIX = 0x80000000,
CELL_AUDIO_EVENTFLAG_DECIMATE_2 = 0x08000000, CELL_AUDIO_EVENTFLAG_DECIMATE_2 = 0x08000000,
CELL_AUDIO_EVENTFLAG_DECIMATE_4 = 0x10000000, CELL_AUDIO_EVENTFLAG_DECIMATE_4 = 0x10000000,
CELL_AUDIO_EVENTFLAG_HEADPHONE = 0x20000000, CELL_AUDIO_EVENTFLAG_HEADPHONE = 0x20000000,
CELL_AUDIO_EVENTFLAG_NOMIX = 0x40000000, CELL_AUDIO_EVENTFLAG_NOMIX = 0x40000000,
CELL_AUDIO_MAX_PORT = 4, CELL_AUDIO_MAX_PORT = 4,
CELL_AUDIO_MAX_PORT_2 = 8, CELL_AUDIO_MAX_PORT_2 = 8,
CELL_AUDIO_MISC_ACCVOL_ALLDEVICE = 0x0000ffffUL, CELL_AUDIO_MISC_ACCVOL_ALLDEVICE = 0x0000ffffUL,
CELL_AUDIO_PERSONAL_DEVICE_PRIMARY = 0x8000, CELL_AUDIO_PERSONAL_DEVICE_PRIMARY = 0x8000,
CELL_AUDIO_PORT_2CH = 2, CELL_AUDIO_PORT_2CH = 2,
CELL_AUDIO_PORT_8CH = 8, CELL_AUDIO_PORT_8CH = 8,
CELL_AUDIO_PORTATTR_BGM = 0x0000000000000010ULL, CELL_AUDIO_PORTATTR_BGM = 0x0000000000000010ULL,
CELL_AUDIO_PORTATTR_INITLEVEL = 0x0000000000001000ULL, CELL_AUDIO_PORTATTR_INITLEVEL = 0x0000000000001000ULL,
CELL_AUDIO_PORTATTR_OUT_NO_ROUTE = 0x0000000000100000ULL, CELL_AUDIO_PORTATTR_OUT_NO_ROUTE = 0x0000000000100000ULL,
@@ -54,6 +64,7 @@ enum
CELL_AUDIO_PORTATTR_OUT_PERSONAL_2 = 0x0000000004000000ULL, CELL_AUDIO_PORTATTR_OUT_PERSONAL_2 = 0x0000000004000000ULL,
CELL_AUDIO_PORTATTR_OUT_PERSONAL_3 = 0x0000000008000000ULL, CELL_AUDIO_PORTATTR_OUT_PERSONAL_3 = 0x0000000008000000ULL,
CELL_AUDIO_PORTATTR_OUT_SECONDARY = 0x0000000000000001ULL, CELL_AUDIO_PORTATTR_OUT_SECONDARY = 0x0000000000000001ULL,
CELL_AUDIO_STATUS_CLOSE = 0x1010, CELL_AUDIO_STATUS_CLOSE = 0x1010,
CELL_AUDIO_STATUS_READY = 1, CELL_AUDIO_STATUS_READY = 1,
CELL_AUDIO_STATUS_RUN = 2, CELL_AUDIO_STATUS_RUN = 2,
@@ -89,6 +100,7 @@ enum : u32
MAX_AUDIO_EVENT_QUEUES = 64, MAX_AUDIO_EVENT_QUEUES = 64,
AUDIO_BLOCK_SIZE_2CH = 2 * AUDIO_BUFFER_SAMPLES, AUDIO_BLOCK_SIZE_2CH = 2 * AUDIO_BUFFER_SAMPLES,
AUDIO_BLOCK_SIZE_6CH = 6 * AUDIO_BUFFER_SAMPLES,
AUDIO_BLOCK_SIZE_8CH = 8 * AUDIO_BUFFER_SAMPLES, AUDIO_BLOCK_SIZE_8CH = 8 * AUDIO_BUFFER_SAMPLES,
PORT_BUFFER_TAG_COUNT = 6, PORT_BUFFER_TAG_COUNT = 6,
@@ -97,6 +109,10 @@ enum : u32
PORT_BUFFER_TAG_DELTA_2CH = PORT_BUFFER_TAG_LAST_2CH / (PORT_BUFFER_TAG_COUNT - 1), PORT_BUFFER_TAG_DELTA_2CH = PORT_BUFFER_TAG_LAST_2CH / (PORT_BUFFER_TAG_COUNT - 1),
PORT_BUFFER_TAG_FIRST_2CH = PORT_BUFFER_TAG_LAST_2CH % (PORT_BUFFER_TAG_COUNT - 1), PORT_BUFFER_TAG_FIRST_2CH = PORT_BUFFER_TAG_LAST_2CH % (PORT_BUFFER_TAG_COUNT - 1),
PORT_BUFFER_TAG_LAST_6CH = AUDIO_BLOCK_SIZE_6CH - 1,
PORT_BUFFER_TAG_DELTA_6CH = PORT_BUFFER_TAG_LAST_6CH / (PORT_BUFFER_TAG_COUNT - 1),
PORT_BUFFER_TAG_FIRST_6CH = PORT_BUFFER_TAG_LAST_6CH % (PORT_BUFFER_TAG_COUNT - 1),
PORT_BUFFER_TAG_LAST_8CH = AUDIO_BLOCK_SIZE_8CH - 1, PORT_BUFFER_TAG_LAST_8CH = AUDIO_BLOCK_SIZE_8CH - 1,
PORT_BUFFER_TAG_DELTA_8CH = PORT_BUFFER_TAG_LAST_8CH / (PORT_BUFFER_TAG_COUNT - 1), PORT_BUFFER_TAG_DELTA_8CH = PORT_BUFFER_TAG_LAST_8CH / (PORT_BUFFER_TAG_COUNT - 1),
PORT_BUFFER_TAG_FIRST_8CH = PORT_BUFFER_TAG_LAST_8CH % (PORT_BUFFER_TAG_COUNT - 1), PORT_BUFFER_TAG_FIRST_8CH = PORT_BUFFER_TAG_LAST_8CH % (PORT_BUFFER_TAG_COUNT - 1),
@@ -171,49 +187,59 @@ struct audio_port
struct cell_audio_config struct cell_audio_config
{ {
const std::shared_ptr<AudioBackend> backend = Emu.GetCallbacks().get_audio(); struct raw_config
{
bool buffering_enabled = false;
s64 desired_buffer_duration = 0;
bool enable_time_stretching = false;
s64 time_stretching_threshold = 0;
bool convert_to_u16 = false;
u32 start_threshold = 0;
u32 sampling_period_multiplier = 0;
audio_downmix downmix = audio_downmix::downmix_to_stereo;
audio_renderer renderer = audio_renderer::null;
} raw;
const u32 audio_channels = AudioBackend::get_channels(); std::shared_ptr<AudioBackend> backend = nullptr;
const u32 audio_sampling_rate = AudioBackend::get_sampling_rate();
const u32 audio_block_period = AUDIO_BUFFER_SAMPLES * 1000000 / audio_sampling_rate;
const u32 audio_buffer_length = AUDIO_BUFFER_SAMPLES * audio_channels; u32 audio_channels = 0;
const u32 audio_buffer_size = audio_buffer_length * AudioBackend::get_sample_size(); u32 audio_sampling_rate = 0;
u32 audio_block_period = 0;
u32 audio_buffer_length = 0;
u32 audio_buffer_size = 0;
/* /*
* Buffering * Buffering
*/ */
const u64 desired_buffer_duration = g_cfg.audio.desired_buffer_duration * 1000llu;
private: u64 desired_buffer_duration = 0;
const bool raw_buffering_enabled = static_cast<bool>(g_cfg.audio.enable_buffering);
public:
// We need a non-blocking backend (implementing play/pause/flush) to be able to do buffering correctly // We need a non-blocking backend (implementing play/pause/flush) to be able to do buffering correctly
// We also need to be able to query the current playing state // We also need to be able to query the current playing state
const bool buffering_enabled = raw_buffering_enabled && backend->has_capability(AudioBackend::PLAY_PAUSE_FLUSH | AudioBackend::IS_PLAYING); bool buffering_enabled = false;
const u64 minimum_block_period = audio_block_period / 2; // the block period will not be dynamically lowered below this value (usecs) u64 minimum_block_period = 0; // the block period will not be dynamically lowered below this value (usecs)
const u64 maximum_block_period = (6 * audio_block_period) / 5; // the block period will not be dynamically increased above this value (usecs) u64 maximum_block_period = 0; // the block period will not be dynamically increased above this value (usecs)
const u32 desired_full_buffers = buffering_enabled ? static_cast<u32>(desired_buffer_duration / audio_block_period) + 3 : 2; u32 desired_full_buffers = 0;
const u32 num_allocated_buffers = desired_full_buffers + EXTRA_AUDIO_BUFFERS; // number of ringbuffer buffers u32 num_allocated_buffers = 0; // number of ringbuffer buffers
const f32 period_average_alpha = 0.02f; // alpha factor for the m_average_period rolling average const f32 period_average_alpha = 0.02f; // alpha factor for the m_average_period rolling average
const s64 period_comparison_margin = 250; // when comparing the current period time with the desired period, if it is below this number of usecs we do not wait any longer const s64 period_comparison_margin = 250; // when comparing the current period time with the desired period, if it is below this number of usecs we do not wait any longer
const u64 fully_untouched_timeout = 2 * audio_block_period; // timeout if the game has not touched any audio buffer yet u64 fully_untouched_timeout = 0; // timeout if the game has not touched any audio buffer yet
const u64 partially_untouched_timeout = 4 * audio_block_period; // timeout if the game has not touched all audio buffers yet u64 partially_untouched_timeout = 0; // timeout if the game has not touched all audio buffers yet
/* /*
* Time Stretching * Time Stretching
*/ */
private:
const bool raw_time_stretching_enabled = buffering_enabled && g_cfg.audio.enable_time_stretching && (g_cfg.audio.time_stretching_threshold > 0);
public:
// We need to be able to set a dynamic frequency ratio to be able to do time stretching
const bool time_stretching_enabled = raw_time_stretching_enabled && backend->has_capability(AudioBackend::SET_FREQUENCY_RATIO);
const f32 time_stretching_threshold = g_cfg.audio.time_stretching_threshold / 100.0f; // we only apply time stretching below this buffer fill rate (adjusted for average period) // We need to be able to set a dynamic frequency ratio to be able to do time stretching
bool time_stretching_enabled = false;
f32 time_stretching_threshold = 0.0f; // we only apply time stretching below this buffer fill rate (adjusted for average period)
const f32 time_stretching_step = 0.1f; // will only reduce/increase the frequency ratio in steps of at least this value const f32 time_stretching_step = 0.1f; // will only reduce/increase the frequency ratio in steps of at least this value
const f32 time_stretching_scale = 0.9f; const f32 time_stretching_scale = 0.9f;
@@ -221,6 +247,11 @@ public:
* Constructor * Constructor
*/ */
cell_audio_config(); cell_audio_config();
/*
* Config changes
*/
void reset();
}; };
class audio_ringbuffer class audio_ringbuffer
@@ -321,12 +352,13 @@ public:
class cell_audio_thread class cell_audio_thread
{ {
private:
std::unique_ptr<audio_ringbuffer> ringbuffer; std::unique_ptr<audio_ringbuffer> ringbuffer;
void reset_ports(s32 offset = 0); void reset_ports(s32 offset = 0);
void advance(u64 timestamp, bool reset = true); void advance(u64 timestamp, bool reset = true);
std::tuple<u32, u32, u32, u32> count_port_buffer_tags(); std::tuple<u32, u32, u32, u32> count_port_buffer_tags();
template <bool DownmixToStereo> template <audio_downmix downmix>
void mix(float *out_buffer, s32 offset = 0); void mix(float *out_buffer, s32 offset = 0);
void finish_port_volume_stepping(); void finish_port_volume_stepping();
@@ -335,8 +367,11 @@ class cell_audio_thread
return (time_left > 350) ? time_left - 250 : 100; return (time_left > 350) ? time_left - 250 : 100;
} }
void update_config();
public: public:
cell_audio_config cfg; cell_audio_config cfg;
atomic_t<bool> m_update_configuration = false;
shared_mutex mutex; shared_mutex mutex;
atomic_t<u32> init = 0; atomic_t<u32> init = 0;
@@ -349,7 +384,7 @@ public:
u8 start_period; // Starting event_period u8 start_period; // Starting event_period
u32 flags; // iFlags u32 flags; // iFlags
u64 source; // Event source u64 source; // Event source
u64 key; // Key std::weak_ptr<lv2_event_queue> port; // Underlying event port
}; };
std::vector<key_info> keys; std::vector<key_info> keys;
@@ -359,7 +394,7 @@ public:
u64 m_counter = 0; u64 m_counter = 0;
u64 m_start_time = 0; u64 m_start_time = 0;
u64 m_dynamic_period = 0; u64 m_dynamic_period = 0;
f32 m_average_playtime; f32 m_average_playtime = 0.0f;
void operator()(); void operator()();
@@ -389,3 +424,9 @@ public:
}; };
using cell_audio = named_thread<cell_audio_thread>; using cell_audio = named_thread<cell_audio_thread>;
namespace audio
{
cell_audio_config::raw_config get_raw_config();
void configure_audio();
}
+2 -2
View File
@@ -1300,7 +1300,7 @@ void camera_context::operator()()
data3 = 0; // unused data3 = 0; // unused
} }
if (queue->send(evt_data.source, CELL_CAMERA_FRAME_UPDATE, data2, data3)) [[likely]] if (queue->send(evt_data.source, CELL_CAMERA_FRAME_UPDATE, data2, data3) == 0) [[likely]]
{ {
++frame_num; ++frame_num;
} }
@@ -1347,7 +1347,7 @@ void camera_context::send_attach_state(bool attached)
if (auto queue = lv2_event_queue::find(key)) if (auto queue = lv2_event_queue::find(key))
{ {
if (queue->send(evt_data.source, attached ? CELL_CAMERA_ATTACH : CELL_CAMERA_DETACH, 0, 0)) [[likely]] if (queue->send(evt_data.source, attached ? CELL_CAMERA_ATTACH : CELL_CAMERA_DETACH, 0, 0) == 0) [[likely]]
{ {
is_attached = attached; is_attached = attached;
} }
+39 -18
View File
@@ -1,22 +1,43 @@
#include "stdafx.h" #include "stdafx.h"
#include "Emu/Cell/PPUModule.h" #include "Emu/Cell/PPUModule.h"
#include "cellDaisy.h" #include "cellDaisy.h"
LOG_CHANNEL(cellDaisy); LOG_CHANNEL(cellDaisy);
template <>
void fmt_class_string<CellDaisyError>::format(std::string& out, u64 arg)
{
format_enum(out, arg, [](CellDaisyError value)
{
switch (value)
{
STR_CASE(CELL_DAISY_ERROR_NO_BEGIN);
STR_CASE(CELL_DAISY_ERROR_INVALID_PORT_ATTACH);
STR_CASE(CELL_DAISY_ERROR_NOT_IMPLEMENTED);
STR_CASE(CELL_DAISY_ERROR_AGAIN);
STR_CASE(CELL_DAISY_ERROR_INVAL);
STR_CASE(CELL_DAISY_ERROR_PERM);
STR_CASE(CELL_DAISY_ERROR_BUSY);
STR_CASE(CELL_DAISY_ERROR_STAT);
}
return unknown;
});
}
using LFQueue2 = struct CellDaisyLFQueue2; using LFQueue2 = struct CellDaisyLFQueue2;
using Lock = struct CellDaisyLock; using Lock = struct CellDaisyLock;
using ScatterGatherInterlock = struct CellDaisyScatterGatherInterlock; using ScatterGatherInterlock = struct CellDaisyScatterGatherInterlock;
using AtomicInterlock = volatile struct CellDaisyAtomicInterlock; using AtomicInterlock = volatile struct CellDaisyAtomicInterlock;
s32 cellDaisyLFQueue2GetPopPointer(vm::ptr<LFQueue2> queue, vm::ptr<s32> pPointer, u32 isBlocking) error_code cellDaisyLFQueue2GetPopPointer(vm::ptr<LFQueue2> queue, vm::ptr<s32> pPointer, u32 isBlocking)
{ {
cellDaisy.todo("cellDaisyLFQueue2GetPopPointer()"); cellDaisy.todo("cellDaisyLFQueue2GetPopPointer()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLFQueue2CompletePopPointer(vm::ptr<LFQueue2> queue, s32 pointer, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal, u32 isQueueFull) error_code cellDaisyLFQueue2CompletePopPointer(vm::ptr<LFQueue2> queue, s32 pointer, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal, u32 isQueueFull)
{ {
cellDaisy.todo("cellDaisyLFQueue2CompletePopPointer()"); cellDaisy.todo("cellDaisyLFQueue2CompletePopPointer()");
return CELL_OK; return CELL_OK;
@@ -27,7 +48,7 @@ void cellDaisyLFQueue2PushOpen(vm::ptr<LFQueue2> queue)
cellDaisy.todo("cellDaisyLFQueue2PushOpen()"); cellDaisy.todo("cellDaisyLFQueue2PushOpen()");
} }
s32 cellDaisyLFQueue2PushClose(vm::ptr<LFQueue2> queue, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal) error_code cellDaisyLFQueue2PushClose(vm::ptr<LFQueue2> queue, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal)
{ {
cellDaisy.todo("cellDaisyLFQueue2PushClose()"); cellDaisy.todo("cellDaisyLFQueue2PushClose()");
return CELL_OK; return CELL_OK;
@@ -38,73 +59,73 @@ void cellDaisyLFQueue2PopOpen(vm::ptr<LFQueue2> queue)
cellDaisy.todo("cellDaisyLFQueue2PopOpen()"); cellDaisy.todo("cellDaisyLFQueue2PopOpen()");
} }
s32 cellDaisyLFQueue2PopClose(vm::ptr<LFQueue2> queue, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal) error_code cellDaisyLFQueue2PopClose(vm::ptr<LFQueue2> queue, vm::ptr<s32(vm::ptr<void>, u32)> fpSendSignal)
{ {
cellDaisy.todo("cellDaisyLFQueue2PopClose()"); cellDaisy.todo("cellDaisyLFQueue2PopClose()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLFQueue2HasUnfinishedConsumer(vm::ptr<LFQueue2> queue, u32 isCancelled) error_code cellDaisyLFQueue2HasUnfinishedConsumer(vm::ptr<LFQueue2> queue, u32 isCancelled)
{ {
cellDaisy.todo("cellDaisyLFQueue2HasUnfinishedConsumer()"); cellDaisy.todo("cellDaisyLFQueue2HasUnfinishedConsumer()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisy_snprintf(vm::ptr<char> buffer, u32 count, vm::cptr<char> fmt, ppu_va_args_t fmt_args) error_code cellDaisy_snprintf(vm::ptr<char> buffer, u32 count, vm::cptr<char> fmt, ppu_va_args_t fmt_args)
{ {
cellDaisy.todo("cellDaisy_snprintf()"); cellDaisy.todo("cellDaisy_snprintf()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_initialize(vm::ptr<Lock> _this, u32 depth) error_code cellDaisyLock_initialize(vm::ptr<Lock> _this, u32 depth)
{ {
cellDaisy.todo("cellDaisyLock_initialize()"); cellDaisy.todo("cellDaisyLock_initialize()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_getNextHeadPointer(vm::ptr<Lock> _this) error_code cellDaisyLock_getNextHeadPointer(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_getNextHeadPointer()"); cellDaisy.todo("cellDaisyLock_getNextHeadPointer()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_getNextTailPointer(vm::ptr<Lock> _this) error_code cellDaisyLock_getNextTailPointer(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_getNextTailPointer()"); cellDaisy.todo("cellDaisyLock_getNextTailPointer()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_completeConsume(vm::ptr<Lock> _this, u32 pointer) error_code cellDaisyLock_completeConsume(vm::ptr<Lock> _this, u32 pointer)
{ {
cellDaisy.todo("cellDaisyLock_completeConsume()"); cellDaisy.todo("cellDaisyLock_completeConsume()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_completeProduce(vm::ptr<Lock> _this, u32 pointer) error_code cellDaisyLock_completeProduce(vm::ptr<Lock> _this, u32 pointer)
{ {
cellDaisy.todo("cellDaisyLock_completeProduce()"); cellDaisy.todo("cellDaisyLock_completeProduce()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_pushOpen(vm::ptr<Lock> _this) error_code cellDaisyLock_pushOpen(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_pushOpen()"); cellDaisy.todo("cellDaisyLock_pushOpen()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_pushClose(vm::ptr<Lock> _this) error_code cellDaisyLock_pushClose(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_pushClose()"); cellDaisy.todo("cellDaisyLock_pushClose()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_popOpen(vm::ptr<Lock> _this) error_code cellDaisyLock_popOpen(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_popOpen()"); cellDaisy.todo("cellDaisyLock_popOpen()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyLock_popClose(vm::ptr<Lock> _this) error_code cellDaisyLock_popClose(vm::ptr<Lock> _this)
{ {
cellDaisy.todo("cellDaisyLock_popClose()"); cellDaisy.todo("cellDaisyLock_popClose()");
return CELL_OK; return CELL_OK;
@@ -125,13 +146,13 @@ void cellDaisyScatterGatherInterlock_9tor(vm::ptr<ScatterGatherInterlock> _this)
cellDaisy.todo("cellDaisyScatterGatherInterlock_9tor()"); cellDaisy.todo("cellDaisyScatterGatherInterlock_9tor()");
} }
s32 cellDaisyScatterGatherInterlock_probe(vm::ptr<ScatterGatherInterlock> _this, u32 isBlocking) error_code cellDaisyScatterGatherInterlock_probe(vm::ptr<ScatterGatherInterlock> _this, u32 isBlocking)
{ {
cellDaisy.todo("cellDaisyScatterGatherInterlock_probe()"); cellDaisy.todo("cellDaisyScatterGatherInterlock_probe()");
return CELL_OK; return CELL_OK;
} }
s32 cellDaisyScatterGatherInterlock_release(vm::ptr<ScatterGatherInterlock> _this) error_code cellDaisyScatterGatherInterlock_release(vm::ptr<ScatterGatherInterlock> _this)
{ {
cellDaisy.todo("cellDaisyScatterGatherInterlock_release()"); cellDaisy.todo("cellDaisyScatterGatherInterlock_release()");
return CELL_OK; return CELL_OK;

Some files were not shown because too many files have changed in this diff Show More